SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000112395 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000112395
Domain Number 1 Region: 153-262,307-578
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.72e-149
Family Myotubularin-like phosphatases 0.0000000262
Further Details:      
 
Domain Number 2 Region: 1087-1161
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 4.08e-21
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0012
Further Details:      
 
Domain Number 3 Region: 51-132
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000156
Family GRAM domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000112395   Gene: ENSDARG00000058305   Transcript: ENSDART00000126132
Sequence length 1170
Comment pep:known chromosome:Zv9:8:4128473:4211150:-1 gene:ENSDARG00000058305 transcript:ENSDART00000126132 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEEGQQSLECIQANQIFPRKPPVLEEEDLQVPFPELHGEFTEYVGRAEDAVIAMSSYRL
HIKFKESVVNVPLQLIECVECRDMFQLHITCKDCKIVRCQFSTFEQCQEWLKRLTAAVRP
PSRIEELFSFAFHAWCVDLYTGEKEQHGDLCRPGDHVMSRFHNEVERMGFDTQNAWRVSE
INNKYKLCSSYPQLLLVPAWITDKELENVAAFRSWKRIPAVVYRHQSTGAVIARCGQPEV
SWWGWRNADDEHLVQSIARACAVDSSSCKGVSNGSLSREYTNGADLSDVDFESSMTNSSE
VETLAIQPRKLLILDARSYAAAVANRAKGGGCECPEYYPNCEVVFMGMANIHSIRKSFQS
LRFLCTQMPDPANWLSALESTKWLQHLSLLLKASLLVSNAVDRDHRPVLVHCSDGWDRTP
QIVALAKLLLDPYYRTIEGFQVLVETEWLDFGHKFADRCGHGENAEDLNERCPVFLQWLD
CVHQLQRQFPCSFEFNEAFLVKLVQHTYSCLFGTFLCNSGKEREDRRIQERTCSVWSLLR
AANRSFGNMLYSSHSETVLHPVCHVRNLMLWTAVYLPSSSPTTPSDDSCAPYPAPGANPE
DQPLGRRPKTRSFDNLPSACEVGNPLTSNRRSSDPSLNEKWQDHRRSLELNIGAGTDGAA
SPEPDERVNGQTMVGIMGTFSNGGTENGEGLKDVRLPMIDGVDEAELTVGVAVGQMENIL
QEATKDESAPDTRSVAKPNETSAVNGKTDDIAQEGRTEDDLESKSLEDGNVNGHCSEDGN
SEASSALSQDTSESQDSEEIEKCTTQEDDSSCNPTILTPNGLRTLTNGHGVEPSIEQAEK
RLSLLESSTETLTEDLGVRPESLGPLSIPPPLKALAESSCLKQGLRTAARTLNNTPKRAS
LSAFPPASTDLLHPMCNGDSPDPEPSTPRTNGERATLSRQVSLASCGSLTLHARGTCSHH
RCLHLGFLGRPSFSPPEPPSSSSRSHLDDDGLTLHTDAIQQRLRQIEAGHQLEVEALKRQ
VQELWSRLESHQAAGMLRLNGDIGDEVTSITDSDFNLEPNCLSRCSTELFSEASWEQVDK
QDTEVTRWYPDHLAAQCYGCERGFWLATRKHHCRNCGNVFCGSCCDQKIPVPSQQLFEPS
RVCRSCFSNLQPPAPPLDLELDKPITASSN
Download sequence
Identical sequences A0A0R4IFR5
ENSDARP00000112395 NP_957158.2.45394 ENSDARP00000112395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]