SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000112540 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDARP00000112540
Domain Number - Region: 40-119
Classification Level Classification E-value
Superfamily F-box domain 0.00048
Family F-box domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000112540   Gene: ENSDARG00000093747   Transcript: ENSDART00000133258
Sequence length 179
Comment pep:novel chromosome:Zv9:4:33226534:33227645:-1 gene:ENSDARG00000093747 transcript:ENSDART00000133258 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQVLRHWCCIVLLTNYPLKSDAERKSLRKGMRTQRAKAIDPIPIDDYLTKMPPEILQQIL
LKVITEDGDVAFLRLSLTSRIYKEIVSDAKFREQAHYIWLDSVINWSRFSEDYKKEFRVP
CSLTECPKCGDIFKDCPPGYVGDGRKGVLRGFYSTIDFPGYCLAECHFNAGGEFPYENV
Download sequence
Identical sequences A3QJY7
ENSDARP00000112540 7955.ENSDARP00000071501 ENSDARP00000112540 NP_001121769.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]