SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Danio rerio 69_9 > ENSDARP00000113204

Domain assignment for ENSDARP00000113204 from Danio rerio 69_9

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSDARP00000113204
Domain Number 1	Region: 8-133
Classification Level	Classification	E-value
Superfamily	Tudor/PWWP/MBT	8.78e-44
Family	MBT repeat	0.0000257
Further Details:

Domain Number 2	Region: 121-196
Classification Level	Classification	E-value
Superfamily	Tudor/PWWP/MBT	2.78e-31
Family	MBT repeat	0.0000343
Further Details:

Domain Number 3	Region: 232-253
Classification Level	Classification	E-value
Superfamily	CCHHC domain	0.000017
Family	CCHHC domain	0.0033
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Cellular Component	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSDARP00000113204 Gene: ENSDARG00000094780 Transcript: ENSDART00000139565
Sequence length	253
Comment	pep:novel chromosome:Zv9:24:43614248:43620225:-1 gene:ENSDARG00000094780 transcript:ENSDART00000139565 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	SSRRHLCCFHPQASSESMFAVGMKLEAVDRKNPCLVCVASIADIVDSRFLVHFDNWDDTY DYWCDASSPHIHPVGWCQDHGRPLTAPQGHPNPEHFIWEDYMRDSGASAAPAESFSEISA HGFQTLQKLEAVDRRNPMLIRVATITDTEDHRVKVHFDGWHEKFDFWVDSDLPDLHPVGW CSRTGHPLEPPPLCHTIRSHDKLPAGPERCEVLLCLAYTSLSDVKSSMNQGVCPTPGCRG IGHIKGAKYTGHH
Download sequence
Identical sequences	ENSDARP00000113204 ENSDARP00000113204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]