SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000113273 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000113273
Domain Number 1 Region: 1-148
Classification Level Classification E-value
Superfamily TPR-like 1.33e-49
Family Tetratricopeptide repeat (TPR) 0.0000022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000113273   Gene: ENSDARG00000095579   Transcript: ENSDART00000135509
Sequence length 155
Comment pep:known chromosome:Zv9:7:21997467:22003543:-1 gene:ENSDARG00000095579 transcript:ENSDART00000135509 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAVVSDIVAPEDLKKFEKKYNAELVKGPVSRDTTFEYAWCLIRSKYTNDIVKGIQLLEE
LVHTSKKDDQRDFLFYLAVANYRLKEYERALKYIRTLLKNEPDNKQALELEKLIKDALKK
DGLVGMAIVGGIGLGVAGLAGLIGLAVSKAHKERS
Download sequence
Identical sequences ENSDARP00000113273 ENSDARP00000113273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]