SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000113558 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000113558
Domain Number 1 Region: 167-290
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.17e-36
Family PLC-like (P variant) 0.0033
Further Details:      
 
Domain Number 2 Region: 6-161
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.55e-26
Family Dual specificity phosphatase-like 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000113558   Gene: ENSDARG00000095654   Transcript: ENSDART00000134204
Sequence length 290
Comment pep:novel chromosome:Zv9:20:6648741:6678963:1 gene:ENSDARG00000095654 transcript:ENSDART00000134204 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEGSEFDLNYITERVIGITFHQTCTEQTYQHNLSRITQLLQSKHADRYMVINLSEHSDD
LCRMNHRVVDLGWPESHAPSLHLLCSVCKNMDSWLSAHPDNVLLLHCKGSKDRVGVVISS
YIQLSSVSTSEEHALDLYSMKRFCSDQMVNLLTPSQKRLLKHQIPLNHSPLFIHHVTIHP
IPDFHPTVCQLFIRVNQGTQTAYTSGLQVDVGLMDRVCFVLDPPQMIKGDIMIVCYHKNV
STRTQETLFRAQFHTAALSAKQFALQKEDLDLANKDPRFPENCVVEVLFS
Download sequence
Identical sequences ENSDARP00000113558

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]