SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000113779 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000113779
Domain Number 1 Region: 900-1017
Classification Level Classification E-value
Superfamily BRCT domain 1.83e-24
Family BRCT domain 0.028
Further Details:      
 
Domain Number 2 Region: 60-182
Classification Level Classification E-value
Superfamily BRCT domain 1.31e-19
Family DNA ligase 0.041
Further Details:      
 
Domain Number 3 Region: 754-830
Classification Level Classification E-value
Superfamily BRCT domain 3.4e-17
Family DNA ligase 0.014
Further Details:      
 
Domain Number 4 Region: 660-744
Classification Level Classification E-value
Superfamily BRCT domain 0.000000000000196
Family BRCT domain 0.047
Further Details:      
 
Domain Number 5 Region: 7-88
Classification Level Classification E-value
Superfamily BRCT domain 0.0000785
Family DNA topoisomerase II binding protein 1, TopBP1 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000113779   Gene: ENSDARG00000005606   Transcript: ENSDART00000144672
Sequence length 1122
Comment pep:known chromosome:Zv9:2:29617508:29638235:-1 gene:ENSDARG00000005606 transcript:ENSDART00000144672 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEDDLKVPEELFKDVKFYVVGDIDQKVVQLLKSGKGKEVSYNALATHIIAEDGDNPEVG
ESREVFDLPVVKPSWVILSVKCGDLLPVTGFSPESGQVFFGVTACLPHLAEDLNALWAFI
TFYGGDCQLHFNKKCTHLVVPEPKGAKYECALRHNNIKIVTPEWILDSVKEKNRKDEMLY
HPRLTLYDAPEEEGSEYENERSSRSEGSYSDRRSPHSRRSSPTSSRDASPAGRRSPSTKH
ERKSELMFDDSDDSSPEKEDRNLNWTPAEVLPPGPAKRRLQPGKETGLINLCANVPPVPG
SFGPPDARMVGAGAGGGVPMGVERLEVMSEWNSAARTLRNITNNTDTQQPSRPSNVAHII
QSFSASSKGVVDHMGNQGQSGIPNQLLLKAQQQLPPEAQQQLLQQQQQQQSHQLQQQQQQ
HQMAQQHPMMLPQVMQMHHHQQQQQHQPPPQQQQQQQNQQGFPQMPPQSHQFLQQQMHQQ
MYSQHQQQQQQQQQQQQQQHAFPQQMRPQQLPRLPLQHQQQHVLQQQLQLQQQHRLQLQL
QQQQQQQQQQQQQQQQQQQQQQQQKQQQQQQQNQQQMHQQHLQQQQHFLQQQLQQQHMQQ
LQQQQQMQQQQQQHLQNQQPLQHQNQQVNPHQTQTMLQPPITSAQLFGHEPGHDIPEEGF
LVGCIFAIADYPEQMADKQLLATWKRIIQLNGGTVDSALNRCTHLLCESQVSNTYLQALR
EGKRCVTAHWLNTVLKKKKMVPPHRTLHLPFSFPPGAKPCAQHIISVTGFVDSDRDDLKL
MAYLAGARYTGYLCRSNTVLICKEPSGLKYEKAKEWRIPCVNAQWLCDILLGNFEALRQI
QHSKYTQFNLPDPLAPNHHLVHNLLSAWRIPVKISPEALASLRLQLKQKQADVSVQPPSK
RPKLEELPTPTKKLPPDSTPYVLFTGFEPLQAQQYIKKLYDLGGEVADSTQKCTHLVANK
VTRTVKFLTAISVVKHIVTPEWLEESWKSQKFVDEQSYMLRDAEAEVLFSFSLEESLKRA
HAAPLFKGKYFYITPGICPSLSTMKLIVESAAGKVLSKQPSYRKIMEHKQNKNLPEIILI
TCENDSHLCREYFLKNIEVYTAELILTGVLTQSLDYESYKFT
Download sequence
Identical sequences F1Q5Z1
ENSDARP00000113779 NP_001005929.2.45394 ENSDARP00000113779

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]