SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000113932 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000113932
Domain Number 1 Region: 7-126
Classification Level Classification E-value
Superfamily PX domain 4.58e-24
Family PX domain 0.0022
Further Details:      
 
Domain Number 2 Region: 228-303
Classification Level Classification E-value
Superfamily MIT domain 8.37e-21
Family MIT domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000113932   Gene: ENSDARG00000094115   Transcript: ENSDART00000131461
Sequence length 312
Comment pep:novel chromosome:Zv9:20:3295503:3315184:-1 gene:ENSDARG00000094115 transcript:ENSDART00000131461 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MISARNKDEIVRFYTVTDPTTHKKGYTVYKVTARIISRNNPEDIQEITVWKRYSDFKKLH
QDLWQIYRNLCGQSELFPPFAKAKVFGRFDDSVIEKRRQCSEDLLQFSANIPALYGSSYI
QDFFKGGEVQDSSELIGPAEPFSDFLADSLLDSSSEVSADISVVVDDLIVTNPCEHERGS
SFSELNSFEVDGDSLVAVDDGMASGSLKQSSHSSGTLSFASGLKNCTGKLDYLEKASEQI
SLAVQKEVEQDFAEAFSYYRRGVDLLLQGVQGEVSPSRREAVKRKTAEYLMRAELISAQL
KDGMGQSSTQSR
Download sequence
Identical sequences ENSDARP00000113932 7955.ENSDARP00000099428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]