SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000114068 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000114068
Domain Number 1 Region: 24-151
Classification Level Classification E-value
Superfamily ADP-ribosylation 1.01e-19
Family ADP-ribosylating toxins 0.064
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000114068
Domain Number - Region: 164-205
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00597
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000114068   Gene: ENSDARG00000088260   Transcript: ENSDART00000144237
Sequence length 219
Comment pep:putative chromosome:Zv9:5:59071374:59073040:-1 gene:ENSDARG00000088260 transcript:ENSDART00000144237 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASISFYGWEAFYDEDRHLQANQEPKSGRLYTMYHGTSVKVARAIISTGFKPSADGMLGP
GVYVSRDQKKAERYPLKSPITDKVVLKLSVDCGKVKRIDKDNHALQKTWHSQGYDTAWVP
PNCGMKAVPSGLEEDCIYDPARIEVTDIALAPNTTILTELKQLIAQNKKSPSKSNTLGNC
GVCKLKLGSAHNIQPCWGCGETICALMTKHRCNFSGLRN
Download sequence
Identical sequences A5PMV4
NP_001093525.1.45394 ENSDARP00000114068 ENSDARP00000114068 7955.ENSDARP00000088160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]