SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000115859 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000115859
Domain Number 1 Region: 449-480,543-742
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 4.77e-75
Family Lesion bypass DNA polymerase (Y-family), catalytic domain 0.0000935
Further Details:      
 
Domain Number 2 Region: 48-134
Classification Level Classification E-value
Superfamily BRCT domain 5.37e-21
Family DNA ligase 0.027
Further Details:      
 
Domain Number 3 Region: 747-860
Classification Level Classification E-value
Superfamily Lesion bypass DNA polymerase (Y-family), little finger domain 0.00000000000000149
Family Lesion bypass DNA polymerase (Y-family), little finger domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000115859   Gene: ENSDARG00000018296   Transcript: ENSDART00000134915
Sequence length 1268
Comment pep:novel chromosome:Zv9:9:22826910:22849951:1 gene:ENSDARG00000018296 transcript:ENSDART00000134915 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRDGWRKKASENDGWGGQGGYMAAKVSKLEEQFQKDAPREQKKDGKSSCIFSGVAIYVN
GYTDPSAAELRRLMMLHGGQFHLYYSRSKTTHIIATNLPNFKIQELKGEKVVRPEWIIDS
IKAGRQLSYIQYQLYAKQKGLNFTRVSGIEGQDPSSNHGPDIKPQPSHTLSKDVLKSTQA
NHMANYTEKTDHQLDIRLRNGLHSIISEVDAEKSRVNGIHDDDDDDDIACSILPRGSQDT
LLTNGHVHPVNGALKPQDFADHHPHVVDKASNQSHLPQDKYREGEEPCCSYTESKANSHL
RSLISAASPAKQPGPHNMQTDLHQKPTSNSGTLGAPQKASLHDQTTVRLNGSYHVTSNSS
TLANSSNQSGKSSAEAGIISEFFSHSRLHHISTWRNEFSEYVNSLQSRRRAAGGAVFSGR
EKLKKLKANCNSVSHFDPGSLMAAPQVRQSCVLHVDMDCFFVSVGIRHRPDLIGKPVAVT
SNRGPGRVAQRPGANPQLEFQYYQNKQKHYRKEKTDGDLEMTPSPQDGEVPSNGVHEDLA
ALSMAEIASCSYEARQAGVRNGMFFGRAKQLCPDLQSVPYDFHAYKEVALAMYEILASYT
HNIEALSCDEALVDATALLVELGVSPDELARSIREDIKEKTGCCASVGMSSNILLARMAT
RKAKPKGQYLLRSEEVDDFIRDQPVSSLPGVGRSMSSKLTSLGVSTCGDLQQLSLSQLQR
EFGPRTGQTLFRFCRGLDDRPVRSEKERKSVSAEMNYNIRFTQVEEAESFLNNLSMEVQK
RLEGAGLRGRRVTLKVMMRKPGAPVEPAKYGGHGICDNFARSVLLAQPTDSGRVIASEAI
KLFHAMKLNVKDMRGVGLQVQQLDGSHADPSGQGPSRGRSIRDLLLAKQSAHSPSKESPS
QDGLISASSSRAFSSNQKRVTPALSPPPSTSSSSSPPPSFTIIDPMPGTSKGDYHHPHTP
NHVRACLNISIEVPSPSQVDPSVLKALPIDIRRQVEETWRYREEQPSTSSHYSTPPRPPS
TPPPGPSLVLQLPNQPGQPCTTGIILELPDFSQVDPDVFAALPRELQEELCSAYRNKGNA
QAQASTVVEQKNSFPQLKQPAVGKLKRRYKKRNTSPAKNGSSPLKKMFPGNSPAKTSPSK
TLPLPLREQDLKCPSSLSTDVPETLPKPIPRPAPTLAGAHEFSEIRTLLREWVTTISEPM
EEDILQVVKYCTELVEDKDLEKLYLVIKYMKRLMQQSSESVWSMAFDFVLDNVQVVVQQT
YGSTLKIT
Download sequence
Identical sequences B0UY97
ENSDARP00000115859 NP_001116772.1.45394 ENSDARP00000115859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]