SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000116677 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000116677
Domain Number 1 Region: 194-284
Classification Level Classification E-value
Superfamily BRCT domain 4.45e-25
Family DNA topoisomerase II binding protein 1, TopBP1 0.051
Further Details:      
 
Domain Number 2 Region: 65-180
Classification Level Classification E-value
Superfamily BRCT domain 4.49e-23
Family DNA ligase 0.064
Further Details:      
 
Domain Number 3 Region: 1271-1370
Classification Level Classification E-value
Superfamily BRCT domain 2.47e-21
Family BRCT domain 0.033
Further Details:      
 
Domain Number 4 Region: 599-730
Classification Level Classification E-value
Superfamily BRCT domain 1.02e-19
Family DNA ligase 0.066
Further Details:      
 
Domain Number 5 Region: 360-449
Classification Level Classification E-value
Superfamily BRCT domain 3.14e-18
Family DNA topoisomerase II binding protein 1, TopBP1 0.0000918
Further Details:      
 
Domain Number 6 Region: 871-997
Classification Level Classification E-value
Superfamily BRCT domain 1e-17
Family DNA ligase 0.092
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000116677
Domain Number - Region: 1398-1488
Classification Level Classification E-value
Superfamily BRCT domain 0.000763
Family DNA ligase 0.027
Further Details:      
 
Domain Number - Region: 538-622
Classification Level Classification E-value
Superfamily BRCT domain 0.0153
Family DNA-repair protein XRCC1 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000116677   Gene: ENSDARG00000059322   Transcript: ENSDART00000140200
Sequence length 1520
Comment pep:known chromosome:Zv9:24:9497490:9535847:1 gene:ENSDARG00000059322 transcript:ENSDART00000140200 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKASKDAYIVKFVESNGQKSDVALQAYKAIVELQSEKYVQMVDEEAALELDHNDKSLFV
FSDFTSSAFDHCRRLGCRIVSPLVVLFCLQKQRCVPKAEQPVYNMSMADVTVSCTNLDKE
ARSEVMDLIQLMGGRVYRDLNVSVTHLVAGEVGSKKYLVAASLGKPILLPSWVKACWEKS
QDSVFHHSELNTEDYRCPVLKGCTVCVTGLSTVERKEVQRLCDQNGATYTGQLKMNECTH
LIVNEPTGQKYEFARKWNVYCVSLHWLFDSIEKGFCQDESRYAVERGDKRKTDDKSGRPN
TSTPTGQSRSKEDGPSLLGLSHISNISLNVNETALTTAGISHIEMPDPVDSFDITVCRVD
DLLDGCKLYLCGLSGKKLEKLRRMVNTAGGLRFNQPTQELTHIVMGEADQGIKAFLDNAT
HRPHIVTVQWLLESFSRGSLLPENGYFHPSFLPPAPAAVDIPALHKAAPRASRPSVAPPP
APSPARQSRAEEDLLSQYMGNDQTVVELPQDTSSRHSVLHPEPLVEGKDSTLAEASEGGL
FFGKRFILVGFGAEAEAQLSELVMENAGKILVGRSRAVAHYAIVPLLGCDVEATVDEVAT
DTWLAMCVEQQCVLPLASHPLFTPVAVREGFSPLKDCVLSVSQFTGAERDSLIQLAKHLG
ASVQDYFVRTANQRKGMLASTHLVLQTPEGTKYQAAQKWGLPAVTIRWVLESARTGKRAD
EGQYLVDLPPSPERTEDSFVGASQKDPPPLRLHQRSPELPLLGPQNSDAITPLDTARFQS
RSVRSAVRKLKQGEEEQAEVTTPGQEEAKGAQQKDSSLHLDTPSRFLSRDKLFGPSFNTK
DVFDHLQTPGNKSQQGQGAETPLSEVIERNLKAAVANSNRSHVTNLAAMTASPQLGKEPE
PEVEQKAAAPLSGVVVCVSKKLSKKQSELNAVAASLGAEFRWSCDDSVTHYIYQGKVGDN
SKEYRAVKERGLYIVSQHWLQACADEQKHVSESLYPFTFNPKMSLTMSQMADSTQRSPPS
ATPRTRLRAFAENEETRLGPDDDITDVSTPKQGSVGEPEKDQTISTEKKNLTETLEMRES
LQRQLQEIMSATKLTSGRRGSSRLAKTGPGGLDSPHTPDSLGRMSRRSRNLEAIRMSRQV
CVDLNTEPSQSEQIVWDDPTAREERAKLADNLQWPGSPSQHSEPLALVPPPHSDHTTNGR
DSMTDSELVEMAAFEVIDAQLKPKGTSSRVDTLHNPKTPEAPSIAFPISKTAALPLPRIE
DEEEELKKDPPRFLLSSLNPQERIDYSHLIEELGGVVLEKQSFDPSCTHVIVGHPLRNEK
YLAAMAAGKWILHRSYLEACRAEGHFIQEDQYEWGSSSILEALPSINSQQKRLALAAMRW
RKTLQGCSNKEGAFGGWIVMLNIDQAREAGFRRLLQSGGAKVLPDPSPSLFKETTHLFVD
FSRLKPGDVRVDISEASAHGVKCLKPEYIADYLMQEPSPSMDAYYLPGAAADETEKVVDA
SSRKRKASGDMSTLKKSRMR
Download sequence
Identical sequences F1R135
ENSDARP00000116677 ENSDARP00000116677 XP_005162624.1.45394 XP_009295567.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]