SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000117166 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000117166
Domain Number 1 Region: 139-277,352-407
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00000000000327
Family WD40-repeat 0.011
Further Details:      
 
Domain Number 2 Region: 1233-1276
Classification Level Classification E-value
Superfamily RING/U-box 0.0000053
Family RING finger domain, C3HC4 0.017
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000117166
Domain Number - Region: 720-856,936-1019
Classification Level Classification E-value
Superfamily ARM repeat 0.00932
Family PBS lyase HEAT-like repeat 0.045
Further Details:      
 
Domain Number - Region: 873-1064
Classification Level Classification E-value
Superfamily ARM repeat 0.0173
Family Clathrin heavy chain proximal leg segment 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000117166   Gene: ENSDARG00000060477   Transcript: ENSDART00000143639
Sequence length 1412
Comment pep:known chromosome:Zv9:1:29071032:29298143:1 gene:ENSDARG00000060477 transcript:ENSDART00000143639 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAESPDCRSLVSASSQLNLMEIEAIDDKEFDIPQVDTPPTLESILNEPEDEDEPFILEDT
CLLNTENIDAHSCETSSLASSDSGDRTHLKRRRKAVETNATVHGSVLRRNVLKGISAQIV
SAADKVDAGLPTAITVSSVIAVGTSHGLALVFDQNQALRLCLGTTATGAEYGAVSALSIN
HDCTRLLCGFAKGQITMWDLANGKLLRTITDAHPPGTAILHVKFTDHPALAVCNDSGGSV
FELSFRRVMGMRTCESRCLFSGSKGEVCCVEPLHAGTELKDHPITQYSLLAMASLTKILL
IGLKPSLKVWMTFPYGKTDPASVPLLAWQFVAAQKAINPVLAFCRGDTIHFLLVKKDESG
TIHVIKQRQLQLNCDLISLSWINPRTLVLMDSTEKLRVVDRPSQEELETVDMAELQLVYN
SSHFKSLATGGNVSQALALVGEKTCYQSVCSYAGQIMYLGTKSVHIMTLRNWRERVDYLL
KQEKFMEALSLAWSFHEGTAKAVLGLFADPAKRKGVVADKMVEILLQYVERSLKKCPEHG
KIQVMEQHFQDVVPVMVDYCLLLQRTDLLFNQIYPRLVENSVARGVFLESLEPYILSERI
GCLTAPVMRDLLSYFQENGMMDSVEGCLVHMDITNLDIQQVVQMCWDNQLYDAMIYVFNS
GMNDYISPMEKLFQAIGPPLQEGKPLTDEHVVMGNKLLVYISCCLAGRAYPLGDIPEDLV
PQVKNQVFEFLIRLHSVEAAQEEEVYPYIRTLLHFDTREFLNVLALTFEDFKNDKQALEY
QQRIVDILLKVMVDNSDFTPSQVGCLFTFLARQLAKPDNTLFVNRKLFDQVLEFLCSPDD
DSRHTERQQVLLELLQVGGVVQFDEGRLLYLAEKAEFYQICEFMYEKKHLYDKIVDCYLK
DPLRKEELFNYIHNILSMPGYSAEEKHSVWVKALQHFKDLVRINAAKTAELVAVHFADEV
HSIITSLQDNYLVFQFLKCLLDPSSREGLNSQTVLKLGPDLHELLVDLLCQFSPQQVIVF
LKTSQDYRLEETIQITEKHKLHEATAYLLERKGDVQGAFQVLLQTLKGKLHKLAMESSDS
DKPDGEEEETADEVQSLLQRVEEALHDIIALCQRSSSGLNQQQREALWFPLLEAMMSPQK
LLKGADTIHTSEALKELTMKVLNSMSSFIAPPAIIQRILQDPVYGKGKLAEIQGLILGML
ETFNYEQTLLETTTNLLNSDLHWSLSHLRKAVCKGLHPRQDHCNICLQQYKRRQESEEEI
VIFSCGHLYHCQCLQRKETGVLSERQYPWSCYKCTSNQGSRPADRASAESSRSRSASLAQ
NKVTSAHRGITAEAHGRKMMTEATLDAQQTQAWDQFRTIYRGPSRLAVLTELTHSHGTER
AGLSNPAHPGTGSIYHSENFQLKLTPPPLVEE
Download sequence
Identical sequences F1QQ05
ENSDARP00000117166 ENSDARP00000117166 NP_001074085.2.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]