SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000117514 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000117514
Domain Number 1 Region: 50-213
Classification Level Classification E-value
Superfamily RUN domain-like 6.67e-30
Family RUN domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000117514   Gene: ENSDARG00000094420   Transcript: ENSDART00000140997
Sequence length 269
Comment pep:novel chromosome:Zv9:22:38160893:38173820:1 gene:ENSDARG00000094420 transcript:ENSDART00000140997 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ISAFTLLLLWCGKHLPPVRTLSDSKPQLNLHYLRIKMEIQEQEDGERRWELWKLLYNLKT
TVEGLLSTNNPNVWSRYGGLQRLHKDMNNILGHGLKHEQIYYKQKDYWRFVWCVRYLCPH
LARHVEQFSQLEPVLSSSVQSFGEGYKAERWLLHSLQAHVLSAQLKPLLQHKMNTQKYYN
DGAFLLSEPHVSAMFQCLEAVEQNNPRMLALIDTVRLSHLKESPLGLMKSQSLCLLPGAP
GHCRPADASQSHRLTTSQSCLTEISNSPQ
Download sequence
Identical sequences 7955.ENSDARP00000101878 ENSDARP00000117514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]