SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000118051 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDARP00000118051
Domain Number - Region: 342-366
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0136
Family CCCH zinc finger 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000118051   Gene: ENSDARG00000062463   Transcript: ENSDART00000143676
Sequence length 838
Comment pep:novel chromosome:Zv9:5:23881919:23889922:1 gene:ENSDARG00000062463 transcript:ENSDART00000143676 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XVRPRSGSSGGVSSAGSGDCPVGRRRDLLIAAKPHRQLCRSSCLDRPSFSQSSTLQELRA
DDTCTDPSQKALAPPSSASPMSLRQTSDRDYQTKMDFALKLGYSGEQVESVLSKLGANAL
INDVLAELVRLGNKGDPESQTAAGSASFAPRTVGAKEAVSPEASLEEDSSDTYDNLRPIV
IDGSNVAMSHGNKEVFSCLGIQLAVDWFLEKGHKDITVFVPAWRKEQSRPDAPIKDQEIL
RKLEKEKILVFTPSRRVQGRRVVCYDDRFIVKLACDSDGIIVSNDNYRDLQNEKPEWKKF
IEERLLMYSFVNDKFMPPDDPLGRHGPSLENFLRKRPVVPEHKKQPCPYGKKCTYGHKCK
YYHPERANQPQRAVADELRAFAKLSAVKTMSEGALAKCGTSGAANKGESGSEAKRVAPKR
QSDPSIRSVACEQEERLCPMRKAEASSVPSLVSALSVPTMPLTKSHAAGALNTRSASSPV
PGSLHFTHSSLEHAGSVQYPPILVTNSQGASVAYGEPFPKYDSVVSDHGYYSMLSDFSTI
SLQDSFCSLEQPEPVGVGGGYSGRAPSMCPEPGRSHSSDSFSSYSGELYLNSLEGSLDDS
MKSAPTQPSAQTRLQAFAHGFHHEALTRVQSYGTDEPKPGPRKQTSAHLAPHTQHPVVGA
RSSCPGDYPPLPQNVLPSVSPSQPGRSLGMTRMDSISDSRLYESNPLRQRRPPLCREQHA
SWDPLPCGNEPYSYGGYGLTGALMPCCERVMVRSMPEKMEQIWRSPWDSVPPPPPATRGP
AGDHQERHPIPEHQYQTYRNLCNIFPAYVVHSVMEKNPHMTDPQQLAAVIVTELRSCH
Download sequence
Identical sequences F1QC40
ENSDARP00000118051 ENSDARP00000118051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]