SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000118806 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000118806
Domain Number 1 Region: 810-939
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 6.04e-29
Family PLC-like (P variant) 0.05
Further Details:      
 
Domain Number 2 Region: 623-766
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.45e-27
Family PLC-like (P variant) 0.00023
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000118806
Domain Number - Region: 59-147
Classification Level Classification E-value
Superfamily Troponin coil-coiled subunits 0.00314
Family Troponin I 0.054
Further Details:      
 
Domain Number - Region: 384-464,531-544
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0175
Family Extended AAA-ATPase domain 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000118806   Gene: ENSDARG00000076055   Transcript: ENSDART00000138541
Sequence length 1342
Comment pep:novel chromosome:Zv9:24:7862140:7890778:-1 gene:ENSDARG00000076055 transcript:ENSDART00000138541 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLAVDETAGDLPVRDVGLRAGLITLLADTDHDTRSWRRQPQVLKIKDRQRLFRVPREQL
EDQCHRLQEENTLLKQHSRTQEQKLRRLSTKLLRLKHGSSASGRDGELEDTIEELEARVA
TLESQKGALQSKLNLAKQHILDLGVRTHIRPRTGRGVDGDGGVRRAAQTAPARCGISSLD
DTRGEMDRLLALLSRSTVIESQQGRVAELELTAQSLRETLRDKEREIEGIVKDLRKQQVD
GHRLIIKDNVDVIRLQKQLSEKSAALLVIQEKFGGLQEAYENQLEEGQKSLKESQEALLG
KVEELSEQLKQEKQRVLTLEGQLSAATFSLQALGELQERVLDLEGERNLLKKSYDSLLES
TMSIQNHQGDKHEEKEERKEELREEGWREELQRLKERLEEARSERKTLEQEKEQMRHEID
QVKKEKERDKDMVMFLREKHDCLEREVLQHRQEVTLLQEKLDSVTKEFDMSVEDLSETLL
QIKAFRMQQETQGVMRFLKTDVKFEDTSRDLTAVQASYAETVLELQKTRDLLLLQHRLNA
DLQNEMTTVLEKSESEREENRRRAEEKDKLLKSRGLQISNLQAQLKELAYSPRNNKRAIP
LQYTWTGLEQDSVRPTVESAIITHLHGGESLLEVHLTGATFTPLGLRLMAQDTGEHQGVA
TFCTYGFLDFEVLSTSLMSGGQPNYGFTSQYALSAFDLEKLMVQGGFIAVELHQALGGVK
FLTRGRARISLMEALQRRGERVKNRTNLIGVDGEVIGILEFWVCLHPQVERTEPQMERVT
SRTPVRHTRGSEWAHGEPEEMYDFGVGIPNELEVVLERCVGLSTRWPGLLPDAYLTYRLY
DLPPHSTPIIQCCVDPVFEDSASYPLAVTTDVLEYLNVGSLWVYVFDDGDSQTSHTYLAK
TPIPLRSLAAGRPIRGDYVLRDPAGSPRGMVRVSLRWKYPFQSPEVPSRQREGAEKERMM
PSAEVSQRPIAKPRSQLRPPSGREATDTHQSTPLRKSERHLITSHQSPSIQVSEASSDRQ
KPPAQPSRSVRRKHRPATLSNQKPTTPPYRSSAMSTQSPDANAVTDFRASVSEPSTPRSQ
RSCRSDSEQEVEEQDDETEDKTQSDVDVLHSEESRESNGSDVVIIPHPPKPQKKGDRLRV
EILSLSFNPSSSIALDQSVHQVYVEYRLLGVPMETTETPMSLRKPTDGEEIHYNFTRVIH
VDSVGAAPLRHYLYTMLEGTDPNQGRLKFTVVSEPMKEQEECEDVGYAYLDLRELLLTGN
DVIEKQINVVSPNEEQEVVGKLKVSVEAAQALTGIYQEYHQTVKRNRRDPPSSTEDEEEE
GTKKKEELHVLDFEVDEDSDFY
Download sequence
Identical sequences E9QHV7
ENSDARP00000118806 ENSDARP00000118806

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]