SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Danio rerio 69_9 > ENSDARP00000120381

Domain assignment for ENSDARP00000120381 from Danio rerio 69_9

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSDARP00000120381
Domain Number 1	Region: 265-322
Classification Level	Classification	E-value
Superfamily	beta-beta-alpha zinc fingers	9.24e-24
Family	Classic zinc finger, C2H2	0.0091
Further Details:

Domain Number 2	Region: 349-408
Classification Level	Classification	E-value
Superfamily	beta-beta-alpha zinc fingers	8.74e-23
Family	Classic zinc finger, C2H2	0.01
Further Details:

Domain Number 3	Region: 70-127
Classification Level	Classification	E-value
Superfamily	beta-beta-alpha zinc fingers	4.62e-22
Family	Classic zinc finger, C2H2	0.011
Further Details:

Domain Number 4	Region: 210-266
Classification Level	Classification	E-value
Superfamily	beta-beta-alpha zinc fingers	9.44e-22
Family	Classic zinc finger, C2H2	0.0078
Further Details:

Domain Number 5	Region: 153-210
Classification Level	Classification	E-value
Superfamily	beta-beta-alpha zinc fingers	1.59e-20
Family	Classic zinc finger, C2H2	0.0066
Further Details:

Domain Number 6	Region: 312-343
Classification Level	Classification	E-value
Superfamily	beta-beta-alpha zinc fingers	0.0000000615
Family	Classic zinc finger, C2H2	0.008
Further Details:

Domain Number 7	Region: 118-148
Classification Level	Classification	E-value
Superfamily	beta-beta-alpha zinc fingers	0.00000227
Family	Classic zinc finger, C2H2	0.024
Further Details:

Weak hits

Sequence:	ENSDARP00000120381
Domain Number -	Region: 10-98
Classification Level	Classification	E-value
Superfamily	FYVE/PHD zinc finger	0.0124
Family	FYVE, a phosphatidylinositol-3-phosphate binding domain	0.066
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Biological Process	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSDARP00000120381 Gene: ENSDARG00000094736 Transcript: ENSDART00000140610
Sequence length	432
Comment	pep:known chromosome:Zv9:22:1526758:1532693:1 gene:ENSDARG00000094736 transcript:ENSDART00000140610 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MSDPEPCRIKQEETEELIDVIVKEEREELSEDEEKHQIKSDLEFQSVTEDSFLIKTTAVK AFTCTQCGKSFGNKSNLNRHMRIHTGEKPYKCSHCDKRFIHSGNLKIHERIHTGRSLFTC TYCGKSFRQSYLHQHMLIHTGEKTHKCDQCHKTFLRPSDLKTHLRVHTKEKPYSCPECGK GFSQHSSLSLHQKIHTGVREFVCRECKKNFITAGDLKKHQMIHTGEKPYKCSHCDKRFSQ LRPMKTHERIHTGEKPLSCSLCGKSFNQSSNLFRHMMIHTGERPHRCDQCGKTFMRTSEL KRHLRFHTKEKPYSCSECGKSFTMKSHCQAHQKIHTGVREFVCFECGKSFIRAEHLKQHQ MTHTGEKPYACSHSLCNKAFRNPAHLKTHERTHTGEKPFTCTQCGKSFSRSTCLHRHTMR NHTNLINAAKHN
Download sequence
Identical sequences	F1QC22 XP_021325073.1.45394 ENSDARP00000120381 7955.ENSDARP00000103062 ENSDARP00000120381

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]