SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000122173 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000122173
Domain Number 1 Region: 323-601
Classification Level Classification E-value
Superfamily RNI-like 1.14e-41
Family Cyclin A/CDK2-associated p19, Skp2 0.0066
Further Details:      
 
Domain Number 2 Region: 267-329
Classification Level Classification E-value
Superfamily F-box domain 0.000000000445
Family F-box domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000122173   Gene: ENSDARG00000026941   Transcript: ENSDART00000137936
Sequence length 616
Comment pep:known chromosome:Zv9:16:34880688:34897268:-1 gene:ENSDARG00000026941 transcript:ENSDART00000137936 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFPMLTLLSMFYYICLRRRSRSGTRSEALGSRRAVELGQRSALPVTVEVEQYGKEILDFS
SHYGSENSMSYTMWNLAGVPNVYPSSGDFTQTAVFRTYGTWWEQCISSTPRFRRTPPSFH
SQDYLELAFEEPVYPTAVEVLETYHPGAIVKIMACSLNPFSQNPPTDVRWEVLWSGKPNK
ALTPQARQFSPNIKQISFTTNLLRLEVNSSLLDYYTELDAVILRGVRERPILALYKIPVI
DINDLSDSEEEISEAGGLCCRSTAENRQSLANGYFDRLPYELIQLIVSHLPVPDLCRLAQ
SCKLFHKHCCDPLQYIQLSLQPYWARLTDASLCHLQSRCTLLQRLNLSWTGNRGAVTPAG
FCSFMKACGASLVCLEVSCCHFLTEACLEVITQTCPCLQELNLASCDRLQPQAFNHIAKL
THLRRLVLYRTKVEQSAILSILTFCPELRHLNLGSCVMIEDYDVVVSMLSARCRSLRSLD
LWRCRNLSERGLAELVSGCRLLEELDLGWCSTLQSSSGCFQHLARSLPRLRKLFLTANRT
VCDADLEELAANCSALQHLDILGTRMVSSASLRKLLQCCPRLKLLDVSFCSQIDSRFVQE
LNGLFPNVSIKKSFTQ
Download sequence
Identical sequences F1QWZ2
ENSDARP00000122173 7955.ENSDARP00000006078 ENSDARP00000122173

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]