SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000122973 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000122973
Domain Number 1 Region: 65-149
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000147
Family Eukaryotic type KH-domain (KH-domain type I) 0.0066
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000122973
Domain Number - Region: 564-647
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 0.0306
Family L-arabinose binding protein-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000122973   Gene: ENSDARG00000092488   Transcript: ENSDART00000143762
Sequence length 801
Comment pep:novel chromosome:Zv9:7:1506079:1534406:1 gene:ENSDARG00000092488 transcript:ENSDART00000143762 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTMSLSVDECGPQEQVEDEFTCAGVLREAIRALQPTVERVFGVKLSIGAEESPSQGGQIW
LQLRGARTQVTAAKLFVKGVVNQEAQKEMQFPEVLHCIFCGAKGLFMDCLIKHTSAHMVV
GSPGFLLISGLTEPVVKAFSFIVDLVEKYRSGQGRRPDSAGASLESRRAFKTLVEELEDR
HTLELLALPVRVKEALLELVRLALQDAATTLQENGGVHEASDNNNSAESSHSQRPLLGQK
HQAHTHTEQGLRVHRGGLGGYTLKHTCTPDQHSQHIHLNSLTFEQHTRVKVLPFIFPKDS
RHFQTPEPPQPDRPPESSGCGEEFQHLLKFFTAMGFTEAVVRSVLARTGPKEASQLLDLI
QQEQDKTDQQNQLGSGEMHAVERPEANQTDAKQDDFVLGVLKAAAATCGYTEEHVMEVYG
NLPEIKPHELLMQLQKQEHAHFNGLRNGSQQADWTTEQNSRLSIHLLSVQDIHPVNSYSQ
SPPNVKQSLDVTSAKFSNTIPKAKPERGAVASVVTGPQRFLEGLKKPFSLQLSDQPGDAQ
LRHVIIDGSNVAMSHGLGVFFSCRGIALAVQHFWAEGHREIMVFVPQWRQKNNSKIKEKH
YLNELHDLGLLSYTPSREVEGKRIISYDDRFMLDLAQKTNGVIVTNDNLRDLVDESPAWR
DIIKKSLLQYVFAGDQFMLPDDPLGRGGPHLRDFLHKHNSSSPVPSSHSFAGVSSPSSAA
PAPRAHTDGLQYRNWTPGSHGWGQGSSAGEEVNERSLEETRRLRQSLVSIFPGQESVIIM
ILQCHPNIRDINRLTELILEQ
Download sequence
Identical sequences ENSDARP00000122973 ENSDARP00000122973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]