SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000123633 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000123633
Domain Number 1 Region: 384-556
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.91e-51
Family SPRY domain 0.00027
Further Details:      
 
Domain Number 2 Region: 8-81
Classification Level Classification E-value
Superfamily RING/U-box 4.64e-20
Family RING finger domain, C3HC4 0.0084
Further Details:      
 
Domain Number 3 Region: 136-195
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000641
Family B-box zinc-binding domain 0.001
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000123633
Domain Number - Region: 239-273
Classification Level Classification E-value
Superfamily MIT domain 0.0392
Family MIT domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000123633   Gene: ENSDARG00000095298   Transcript: ENSDART00000147469
Sequence length 562
Comment pep:known chromosome:Zv9:15:40272671:40274933:-1 gene:ENSDARG00000095298 transcript:ENSDART00000147469 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSESSSSEYVDQFSCPVCLDLLKEPVTIPCGHSYCMSCITDCWSLKEQGPPYRCPQCRES
FSQRPLLKKNTLIAEMMETLQKTALQTPAAAAVDCDVCTTEKNRAVKSCLQCLASFCQTH
LQLHYESPAFMKHKLVDASRHIQENICPSHGRPLEIYCQDDHQCICCMCTDNHKGHSVVS
VDSEWTSKKEELEEMKLKCLKLIKDREKGQQDLSKATKNLKSSADEAVERMEKVFTELIC
SLEKKRSEIKEQIRAQEKTETDRAEQLHQHLHQELTQLRKTQAEIDKLLTTEDQIHCLKS
CESVCVLPTFKDVPSFTSHTHLSFKDLSISAFREALEDACQQQTDAISREGFSASSTSKI
TECIIHRMSNVHVVQTPQPKSEHDFLQYYCKLQMDSSTAHRELKLSEEKRKVSFSDEVQP
YPDHPQRFDWFHYILCREGLTGRCYWEVECSGDIWGVAVCYRGIRRKGNSDDCKLGFNKV
SWRLNRLQQNITYIRNKVQVRIKAGCFSRIGVYLDHRAGILSFYSVSDTNTLLYKVQTTF
TEPLYPAFIIGQGSSVRIFDKR
Download sequence
Identical sequences ENSDARP00000123633 ENSDARP00000123633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]