SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000123635 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000123635
Domain Number 1 Region: 39-122
Classification Level Classification E-value
Superfamily F-box domain 0.00000654
Family F-box domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000123635   Gene: ENSDARG00000094500   Transcript: ENSDART00000135121
Sequence length 182
Comment pep:putative chromosome:Zv9:4:58095115:58096225:1 gene:ENSDARG00000094500 transcript:ENSDART00000135121 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XSDMQVLRHWWCIVLLTNYPLKSDAERKSLRKRMRTQRAEAIDPVPADDYLTTMPPEILR
QILLKVITEDGDVAFLRLSLTCRIFKEIVSNAKFREQAHYIWLDSVINWSRFSEDYKKEF
RVPYSLTECPECGDIFKDCPPGYVGDGRKGVLRGFYSTIDFPGYCSAECHFNAGGEFPYE
NI
Download sequence
Identical sequences F1QJS0
ENSDARP00000123635 ENSDARP00000123635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]