SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000124376 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000124376
Domain Number 1 Region: 170-292
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.62e-39
Family Eukaryotic type KH-domain (KH-domain type I) 0.00000126
Further Details:      
 
Domain Number 2 Region: 76-168
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.8e-26
Family Cold shock DNA-binding domain-like 0.00000914
Further Details:      
 
Domain Number 3 Region: 27-76
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 0.00000000000012
Family ECR1 N-terminal domain-like 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000124376   Gene: ENSDARG00000028688   Transcript: ENSDART00000149195
Sequence length 295
Comment pep:known chromosome:Zv9:5:75251684:75257645:1 gene:ENSDARG00000028688 transcript:ENSDART00000149195 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVEMRLPAVHKHVSLKTGQSSREDKHLVVPGDVITSDTGFMRGHGTYMDEDRLTASVAG
QVERVNKLICVKPLKTRYNGEVGDVVVGRITEVQQKRWKVETNSRLDSVLLLSAVNLPGG
ELRRRSTQDELAMRDYLQEGDLISAEVQSIFSDGALSLHTRSLKYGKLGQGVLVYVSPSL
VKRQKTHFHNLPCGASLILGNNGYVWLSPTPALQEEQAGGFYTSMEPVSLSDREVVSRLR
NCLLALANQKVLLFDTSVLYCYEASLQHQIKDILKPEIMEEIVLETRQRLMEHEG
Download sequence
Identical sequences F8W3K6
ENSDARP00000124376 NP_001017572.2.45394 ENSDARP00000124376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]