SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000125093 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000125093
Domain Number 1 Region: 275-361
Classification Level Classification E-value
Superfamily BRCT domain 9.95e-21
Family BRCT domain 0.011
Further Details:      
 
Domain Number 2 Region: 12-104
Classification Level Classification E-value
Superfamily BRCT domain 4.45e-17
Family BRCT domain 0.062
Further Details:      
 
Domain Number 3 Region: 383-462
Classification Level Classification E-value
Superfamily BRCT domain 0.000000000419
Family DNA ligase 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000125093   Gene: ENSDARG00000058372   Transcript: ENSDART00000148907
Sequence length 463
Comment pep:novel chromosome:Zv9:13:6213585:6251002:1 gene:ENSDARG00000058372 transcript:ENSDART00000148907 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGVTLTTSTAFLKDVVAYVDVWSASRMEDYSDPFIEQLQDMGAQVSKTLNKQVTHVIFK
HGRPSTWKKALKIGVKIVSVHWVARCKETNQHINEELFPAQNEESKRHLTNKRTHCCMQP
RNIPIKTPENDRRLKRKIDKMMEGLVPSSPIVSDTSPFIIDEERGIVYSPSLKRSDSMAQ
RLKEMKAGREHLSPTASQKQDIGSEHDPSPPASTALSFLQQLEEEPLDPFSVSHCDALKK
RVVGKENKSTTDGIERSSEMCSKVENMKKDKCLKKNRTLVMTSMPTEKQEVVFKVIRNLG
GFTVVDDVCESTSHVVSGSPRRTVNILLGIARGCWILSFEWIMWCLEHQQWVSEEPFELS
EHFPAAPICRLQQHLSAGEYQQDLFHNQLPMFVSPYSQPPCGRLKELIKLCGGTVCRSVR
QAGICIGGYNGKKPEGSRSLSEQWILDCVTHLILLPYKNYVLE
Download sequence
Identical sequences F8W5H6
ENSDARP00000125093 NP_001035453.2.45394 ENSDARP00000125093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]