SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000125622 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDARP00000125622
Domain Number - Region: 116-245
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.000407
Family WD40-repeat 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000125622   Gene: ENSDARG00000096310   Transcript: ENSDART00000150914
Sequence length 841
Comment pep:novel chromosome:Zv9:21:5787537:5806388:1 gene:ENSDARG00000096310 transcript:ENSDART00000150914 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XKSSRKVRHIHRLLSDIVTDVPQPLLCSLLHEELTYQSEQQQFSADATGGALGFLPFYES
EKGSDGCLIYSSGALMDKICFHRVAQEYKDDGTPTFNMGSEPVVFNLNAAARQISCGNYE
NSVHVAVRSDYFCGAWFVFDKLKPSLVDVIQTKQRFSCVTVSPHLPGEIVVANEQGAAYL
WTPKKGLQKFREEDANLYFNAKSPWRWCDFSCHPRVLVYADRTGAELTDIRSADCNHTLF
RIGKTPACLSGERVILVKYLGNIHPHHHLINTQFSSYIMDERVPSIPMLKWDHMMDFPPI
YTCALPPKSQSQSCKVLLGAQRSQEIMLLQYTGGRQHACQTQGPIQKLLCPKDSLSHLNL
QLPHKRRIAQKRLNSPAAGFMALQNKDYLSVFHLTDTADIFYQTLKLQTDQTTTDAQDPE
QAVRVEPTVGDNENLQLQTNDNISENDSETEGQQVPLSPLKVIDNVDNDPLNNLDANENV
SNEPPNNSTGINPSGSTKPLKQSKYLDLQRIWDVWFDYLFKNSADKKWLPQFRRIYTADI
KCLRTNKQDKLEEDRLTRLRKDLQEVMRNRDLLVHGVTYLPHLNVEQIPDPVDPEDWPDD
VSQRMAASWEGNWKSWWEDKLGLNRDKKIANLRQKRRREKQARSRSRTSLSGSFASSVSN
PDSLSGWSSATSQYLGSDEETLENSQATDIEEWKSRPENRNKSPILLRRFLNEQSVEKEA
VISPLRRLEQELMRSSKSQPSLQVKQPTSGTPKATVEKDSVDHPGLVSPLRKLSIPLKRC
KEFYLSSLPTSQASTQDSTADGGFSVPQARLLSPAAPSQRASQIRSSSQASQPKKKSRMG
F
Download sequence
Identical sequences I3IRW4
ENSDARP00000125622 ENSDARP00000125622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]