SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000001911 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000001911
Domain Number 1 Region: 310-572
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.93e-67
Family Nuclear receptor ligand-binding domain 0.00000000782
Further Details:      
 
Domain Number 2 Region: 238-315
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.02e-27
Family Nuclear receptor 0.0000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000001911   Gene: ENSDARG00000000796   Transcript: ENSDART00000000876
Sequence length 574
Comment pep:known chromosome:Zv9:23:32389912:32396444:-1 gene:ENSDARG00000000796 transcript:ENSDART00000000876 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTCVQSQHGVQSYESSLFSSEFLNPDFTSRLAMDVTEQREQLSAPSLPSITSLVGGYVGE
FDTYSCQIATGAASTCVGSTSGQLDSFKLDDLQVYGCYPGTFALSYLDETLSSSGGSNCF
GSPASAPSPSTPGYQHMSAWDSTFGPCSPDEGCWGSEKPLNQAASFFTFGHVTADELSPL
GQMQSQIPDQDPFSHTPQHGSPLPFSPLSLEQGSRDGSGLMDGHLSPKVRSPTGNEGRCA
VCGDNASCQHYGVRTCEGCKGFFKRTVQKNAKYVCLANKDCPVDKRRRNRCQFCRFQKCL
AVGMVKEVVRTDSLKGRRGRLPSKPKAVQDSVSVSSPVNIIASLVTAHIDSNPASANLDY
SKYQESTSGLPEKEDANDIQQFYDLLTGSMDVIRKWAGSIPGFSAFCKEDQELLLESAFV
ELFILRLAYRSNPETDKLIFCNGVVLHRTQCVRSFGDWIDSIMEFSQSLHRLNLDISAFS
CLATLVIITDRHGLKEPKRIEDFQNRLITCLRDHVSTSALEVGRPNSLSRLLSKLPELRT
LCTQGLQRIFYLKLEDLVPPPPIVDKIFMDTLPF
Download sequence
Identical sequences Q6GMG3
ENSDARP00000001911 ENSDARP00000001911 NP_001002173.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]