SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000002714 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDARP00000002714
Domain Number - Region: 223-267
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0165
Family Tudor domain 0.026
Further Details:      
 
Domain Number - Region: 157-207
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0602
Family Tudor domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000002714   Gene: ENSDARG00000002339   Transcript: ENSDART00000007726
Sequence length 293
Comment pep:known chromosome:Zv9:3:15094319:15101204:-1 gene:ENSDARG00000002339 transcript:ENSDART00000007726 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALVSADTKIAELLNELHQLIKQTQEERSRSEHNLLNIQKTHERMQTENKTSPYYRTKLR
GLYTTAKADAEAECSILRRALDKIAEIKSLLEERRIAARMAGVYSDNDPPRKTMRRGVLM
TLLQQSAMTLPLWIGKPGESPPPLCGAIPASSDYVAKQGDKVAARVKAVDGDEQWILAEV
VSYNHSTNKYEVDDIDEEGKERHTLSRRRIIPLPQWKANPETDPEALFSKDQLVLALYPQ
TTCFYRALIHTPPHRPQDDYSVLFEDTSYADGYSPPLNVAQRYVVACKENKKK
Download sequence
Identical sequences F1QQW7
ENSDARP00000002714 7955.ENSDARP00000002714 XP_005163867.1.45394 XP_005163868.1.45394 ENSDARP00000002714

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]