SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000004918 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000004918
Domain Number 1 Region: 104-373
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.84e-82
Family Nuclear receptor ligand-binding domain 0.00000000137
Further Details:      
 
Domain Number 2 Region: 50-128
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 7.49e-27
Family Nuclear receptor 0.00000988
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000004918   Gene: ENSDARG00000035127   Transcript: ENSDART00000016321
Sequence length 379
Comment pep:known chromosome:Zv9:5:68053454:68088764:-1 gene:ENSDARG00000035127 transcript:ENSDART00000016321 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVPEQKQTVQLSSPMNAVSSSEDIKPPLGLNGVMKVPAQPIGTLSLSLTKHICAICGDR
SSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCMIDKRQRNRCQYCRYQKCLAMGMK
REAVQEERQRAKERSEAEFGGCANEDMPVEKILEAELAVEPKTETYVEANLSPSANSPND
PVTNICQAADKQLFTLVEWAKRIPHFSDLPLDDQVILLRAGWNELLIASFSHRSIAVKDG
ILLATGLHVHRNSAHTAGVGAIFDRVLTELVSKMRDMQMDKTELGCLRAIVLFNPDSKGL
SNPSEVEALRERVYASLEAYCKHKYPDQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIG
DTPIDTFLMEMLEAPHQIT
Download sequence
Identical sequences F1RDN3
ENSDARP00000004918 7955.ENSDARP00000004918 ENSDARP00000004918

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]