SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000007921 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000007921
Domain Number 1 Region: 473-651
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.94e-50
Family SPRY domain 0.001
Further Details:      
 
Domain Number 2 Region: 10-82
Classification Level Classification E-value
Superfamily RING/U-box 6.31e-17
Family RING finger domain, C3HC4 0.019
Further Details:      
 
Domain Number 3 Region: 144-208
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000397
Family B-box zinc-binding domain 0.0014
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000007921
Domain Number - Region: 101-134
Classification Level Classification E-value
Superfamily RING/U-box 0.0706
Family ZZ domain 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000007921   Gene: ENSDARG00000015865   Transcript: ENSDART00000013659
Sequence length 654
Comment pep:known chromosome:Zv9:6:19509769:19522065:1 gene:ENSDARG00000015865 transcript:ENSDART00000013659 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEQMSLLGLEDELTCSICLCLFDNPVSLICGHSFCANCLEETWKDKISSLFCPHCRMAF
SSKPELKKNTVLGAVLDAYRVKAGISEPVKNPVEEKKKDPDAIKCDSCMEAKAVKTCLTC
MASYCEDHVRPHRENAIFRAHQLCDPLPDLMERLCSDHGKLMEFYCIQHQSCICSTCLQY
IHKGCEFITADERRFKQKTDLTDKLNMIEGKMDKNEQVITQMKEQQNKLKDLAATRKRIL
EAEYSQIREMIDRDEKEAMLAIDKEQERGQSKLVSLMKKFNENIEKMERTKCEINSLLDQ
SQSLSFLKASIDLPSVINFEPYNPRMNLDSKEVIAYHSSAVALKEWITKLMEQSTENRIS
VLKPEFEKSVLGTGYQSPGILGGTPAFLPNPRDMSYMRPPCSSKPKVLPSKKKNPDRRDT
KEKPNRSKNPTQGINPVFSKSMDNLNELRPKTVDIIDINQPASSSAVQNVKRSDLLKYGT
ILHFDVRTAHKRISLSENNTKATVSDDPANYPEIPHRFSVCSQVLCTKGFSQGRHYWEIK
MSSNNFCGLGLAYGKIDRKGPSSRLGRNAESWCVEWFNVKLSAWHNSFETVLENPNPSRV
GILLDCDQGSATFYNVQDRAYPFHTFVFPFTEAVYPAFWIFSNGSSVSLCKLNN
Download sequence
Identical sequences A0A0R4IKI3
ENSDARP00000007921 ENSDARP00000007921 7955.ENSDARP00000007921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]