SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000008536 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000008536
Domain Number 1 Region: 14-237
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.75e-28
Family Nuclear receptor ligand-binding domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000008536   Gene: ENSDARG00000004355   Transcript: ENSDART00000011128
Sequence length 241
Comment pep:novel chromosome:Zv9:19:30604663:30606958:-1 gene:ENSDARG00000004355 transcript:ENSDART00000011128 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PHGILFNILTRKPEFAYFTSPEPCHCNFECFVSLKNPEITCPAAFQVLTKSIHFMQSSLS
HQNLSSSERLCLLQKRWVPLFILGLAQENISFEVMDFPVGSILRNILLSGQQKPDDCPLT
LAKVNKLKMFLDKVWSLQLSLKEYACLKGAILFSQVLDSPGLKSSLVIAGLQEEFAHDLH
MLILSRQRSEEHWTIMDVLFTACTLQMEARSMVTELFFRPIMGKMDIQELLNEIINNNVG
L
Download sequence
Identical sequences A0A0R4IFS6
ENSDARP00000008536 ENSDARP00000008536

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]