SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000011795 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000011795
Domain Number 1 Region: 669-794
Classification Level Classification E-value
Superfamily Bromodomain 1.57e-34
Family Bromodomain 0.00000245
Further Details:      
 
Domain Number 2 Region: 472-619
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 3.14e-21
Family N-acetyl transferase, NAT 0.0000000764
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000011795   Gene: ENSDARG00000006017   Transcript: ENSDART00000028072
Sequence length 800
Comment pep:known chromosome:Zv9:3:17297713:17323607:1 gene:ENSDARG00000006017 transcript:ENSDART00000028072 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADPAAQSSAQPRLQQAQSSGPTGSNSNPGAGSSDPARPGLSQQQWSSQKKAQVRSFPRA
KKLEKLGVFSSCKANDACKCNGWKNPNPPTAARMELQQQAASLTETCRSCGHSLAEHVSH
LENVSEEEINRLLGMVVDVENLFMSVHKEEDTDTKQVYFYLFKLLRKCILQMGKPVVEGS
LGSPPFEKPNIEQGVLNFVQYKFSHLAPKERQTMYELSKMFLLCLNYWKLETPSQFRQRA
QKEDAAAYKVDYTRWLCYCHVPQSNDSLPRYETCQVFGRSLLKSIFTVTRRQLLEKFRVE
KDKLPPEKRTLILTHFPKFLSMLEEEIYGENSPIWEADFTMPASEGTQLGHQTAMSVLSP
VSISGSPHSKGSSASALGVTGLDVASSEPTIGEKRKLPEALTLEDAKRIRVMGDIPMELV
NEVMKTITDPAAMLGPETSLLSANAARDETARLEERRGIIEFHVIGNSLSQKSNKKILMW
LVGLQNVFSHQLPRMPKEYITRLVFDPKHKTLALIKDGRVIGGICFRMFPTQGFTEIVFC
AVTSNEQVKGYGTHLMNHLKEYHIKHGILYFLTYADEYAIGYFKKQGFSKDIKVPKSRYL
GYIKDYEGATLMECELNPRIPYTELSHIIKRQKEIIKKLIERKQNQIRKVYPGLTCFKEG
VRQIPVESIPGIRETGWKPSAKEKSKELKDPDLLYNMLKNLLAQIKEQTHPDAWPFMEPV
KKSEAPDYYEVIRFPIDLKTMTERLKNRYYVTKKLFIADLQRVITNCREYNPPDSEYCKS
ANTLEKFFYFKLKEAGLIDK
Download sequence
Identical sequences ENSDARP00000011795 ENSDARP00000011795

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]