SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000013317 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000013317
Domain Number 1 Region: 95-392
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.1e-61
Family Nuclear receptor ligand-binding domain 0.0000193
Further Details:      
 
Domain Number 2 Region: 24-110
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.12e-28
Family Nuclear receptor 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000013317   Gene: ENSDARG00000017107   Transcript: ENSDART00000026635
Sequence length 396
Comment pep:known chromosome:Zv9:20:32476277:32485287:-1 gene:ENSDARG00000017107 transcript:ENSDART00000026635 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKPAGSTSGCLDILNVKSSRILDIPCKVCGDRSSGKHYGVYACDGCSGFFKRSIRRNRT
YVCKSGTQGGCPVDKTHRNQCRACRLKKCLEVNMNKDAVQHERGPRTSTIRKQVALYFRG
HKEVNGSSTHFPSTSIPGPPFFTTVTQLEPHNLELNTVTSTPERQAIVGLAQPTPKYPHE
VSGTPMYLYEVATESVCESAARLLFMSIKWAKSVPAFSTLPLPDQLILLEDAWRELFVLG
IAQWAIPVDSSTLLAVSGMNTENTDSQRLNKIISEIQALQEVVTRFRQLRLDATEFACLK
CIVTFKAVPTHSGSELRSFRNASAIAALQDEAQLTLNSYIHTRYPTQPCRFGKLLLLLPA
LRSVGPSTIEEVFFKKTIGNVPITRLLSDMYKSSDI
Download sequence
Identical sequences Q6DEH0
ENSDARP00000013317 NP_001003608.1.45394 ENSDARP00000013317 7955.ENSDARP00000013317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]