SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000015055 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000015055
Domain Number 1 Region: 1-54
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 2.86e-22
Family Tudor domain 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000015055   Gene: ENSDARG00000014013   Transcript: ENSDART00000019145
Sequence length 619
Comment pep:known chromosome:Zv9:20:36420271:36441530:-1 gene:ENSDARG00000014013 transcript:ENSDART00000019145 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPARFQIGDTVMGRWPGSNLYYEVKVMSFDNKTRLYTVIYKDGTELELKESDITSVVIF
QTAGRSRSRSRSPGRSPGRSSARSPGRPRRSRSRSPARTPRRASSRSTEVRKEKLKEVLE
VRLTPVAMKHENNSSNSKSEKKEENNTAKAAPVVTEEKTETESENQTGGRYNLRRRKDQG
DGKAVELEKAVESEPLLQTKAPAAVKTADLEFGGRVGVLFLMFLLPVAVLVLLILCGQKD
ASLQSFPLELPALQSVWDCQVFGIVLLWLLFQAFLSLLPVGKLVEGMPLKNGKTLKYRIN
GFYALLLTAVAAGVAVYQEVDLSYIHAHFLQFYTSALLIATLLSIYLFIRSRWASKDELA
PGGNSGYIIYDFFMGRELNPRIKSFDIKFFCEMRPGLMGWVLINFAMLLAEMKQQNLENP
SPAMLLVNIFQLLWVIDGLWHEEKLLTMMDIMYDGFGFMLTFGDLAFVPFTFTCQAYYLV
NHPNELSVFWIITLIAMNGVGYYIFRKANSQKFAFRKNPSDPAVSHLKTIPTATGKSLIV
SGLWGFVRHPNYLGDIIMALAWSLPCGFNNLVPYFYLIYLVTLLVHRNARDERQCRKKYG
SAWEEYCKAVPYRIFPRVY
Download sequence
Identical sequences Q5RJ97
ENSDARP00000015055 7955.ENSDARP00000015055 XP_021324046.1.45394 ENSDARP00000015055 ENSDARP00000104747

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]