SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000015215 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000015215
Domain Number 1 Region: 214-227,373-611
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.84e-63
Family Nuclear receptor ligand-binding domain 0.0000581
Further Details:      
 
Domain Number 2 Region: 144-225
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.22e-31
Family Nuclear receptor 0.0000765
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000015215   Gene: ENSDARG00000042477   Transcript: ENSDART00000011597
Sequence length 623
Comment pep:known chromosome:Zv9:8:55366298:55382248:-1 gene:ENSDARG00000042477 transcript:ENSDART00000011597 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTNVELLAQQILTTEQLSEVQLSPSGSSVMSGSPQRIQIISTEPSVTSPQRIQIVTEQQ
TGQKIQIVTALDSSVPKQQFLLASPDGSPAGKVLLASPESSSAKQLIFATADSLVPGRIQ
FVTDAVSVERLLGKGTDLSRVQPIEYCVVCGDKASGRHYGAVSCEGCKGFFKRSVRKSLT
YSCRSNQDCVINKHHRNRCQFCRLRKCLEMGMKMESVQSERKPIDLPREKPANCAASTEK
IYIRKDLRSPLIATPTFISEKDSSRSKLLDSGMLVNIQQPLIQADGTLLLATDKTESGQG
DLGTLANVVTSLANLNDSLSNGEATDGQLEESPSEITRAFDTLAKALNPGELTESQSLSE
VDGVGGATIQVISRDQISPLIEVEGPLLTDTHVSFKLTMPSPMPEYLNVHYICESASRLL
FLSMHWARSIPAFLALGQECNTALVRACWNELFILGLAQCAQIMSLSTILTAIVNHLQSS
IQDVDKLSSERIKLVMEHIWKLQEFCNSMAKLQTDAYEYAYLKAIVLFSPDHPGLSSCSQ
IEKFQEKAQMELQDYVQKTYPDETYRLARILLRLPALRLMSSSITEELFFTGLIGNVPID
SIIPYILKMETADYNSQITAPSV
Download sequence
Identical sequences F6PDV8
7955.ENSDARP00000015215 ENSDARP00000015215 ENSDARP00000107308 ENSDARP00000015215 NP_001116766.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]