SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000017420 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000017420
Domain Number 1 Region: 168-472
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.33e-69
Family Tandem AAA-ATPase domain 0.0000526
Further Details:      
 
Domain Number 2 Region: 2-166
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.08e-36
Family Tandem AAA-ATPase domain 0.00053
Further Details:      
 
Domain Number 3 Region: 595-678
Classification Level Classification E-value
Superfamily Bromodomain 0.0000000458
Family Bromodomain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000017420   Gene: ENSDARG00000008350   Transcript: ENSDART00000003698
Sequence length 678
Comment pep:known scaffold:Zv9:Zv9_NA996:105:10087:1 gene:ENSDARG00000008350 transcript:ENSDART00000003698 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TLSNWVYEFDKWAPSVVKVSYKGSPAARRAFVPQLRSGKFNVLLTTYEYIIKDKQILAII
RWKYMIVDEGHRMKNHHCKLTQVLNTHYLAPRRVLLTGTPLQNKLPELWALLNFLLPTIF
KSCSTFEQWFNAPFAMTGEKVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVE
YVIKCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLKYTIMQLRKICNHPYMFQ
QIEESFSEHLGFSGGIVLDLYRASGKFEVLDRILPKLRATNHKVLLFCQMTSLMTIMEDY
FAYRNFKYLRLDGTTKAEDRGMLLKTFNDPASQYFIFLLSTRAGGLGLNLQSADTVIIFD
SDWNPHQDLQAQDRAHRIGQLNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFD
QKSSSHERRAFLQAILEHEEQDEVPDDETVNQMIARSEDEFDQFMRMDLDRRREEARNPK
RKPRLMEEDELPTWIMKDDAEVERLTCEEEEEKMFGRGSRQRKEVDYSDSLTEKQWLLSL
QAIEDGTLEEIEEEVRHRKSARKRRRDRDRDPDSVPSTSARAGGRERDDDSKRQKKRGRP
PTEKLSPNPPALTKKMKKIVDAVIKYKEKCVVLQVSGSPGILCRGGEGGRQLSEVFIQLP
SRKELPEYYELIRKPVDF
Download sequence
Identical sequences ENSDARP00000017420 ENSDARP00000017420

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]