SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000017772 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000017772
Domain Number 1 Region: 365-539
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.84e-58
Family SPRY domain 0.00018
Further Details:      
 
Domain Number 2 Region: 10-83
Classification Level Classification E-value
Superfamily RING/U-box 3.53e-19
Family RING finger domain, C3HC4 0.011
Further Details:      
 
Domain Number 3 Region: 133-196
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 5.65e-16
Family B-box zinc-binding domain 0.0006
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000017772
Domain Number - Region: 204-285
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0301
Family Mitotic arrest deficient-like 1, Mad1 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000017772   Gene: ENSDARG00000038646   Transcript: ENSDART00000005767
Sequence length 546
Comment pep:known chromosome:Zv9:2:42809828:42816259:1 gene:ENSDARG00000038646 transcript:ENSDART00000005767 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAESSVCLAQEQFSCSICLDLLKDSVAIPCGHSYCMSCISDCWDQDERKGVYSCPQCRQS
FTPRPALGKNTMLTEVMENIRKRKLQAGDVECDVCTGRKFKAVKSCLVCLESYCQTHFQR
HEEFHSRKRHKVTDATGRLQEMICPLHEKLLEIFCRTDQCCICYLCTMDKHKNHDTVSAA
AEWTDKKIQLAEMQKTTHQRMVERQKEREELRAAVESHKRSAQAAVEDTESIFTELIFSF
ERSCSEVTQLITDQQKAAEGRAEERLKQLEQEIDDLRRRNTELEQLSHTDHHIHFLKSFQ
SLSSPPGSTDSSSITVSSRISFDDVGKLSHLRKKLEHFCREEIEKISSKVRDINIISISA
EPKTRQEFLQYSRQLTFDPNTVNTSLVLSKKNRVIEYTDKVQQYPDHPDRFDCWPQVLCR
ESECGRFYWEVEWNGYIEISVSYKSISRKGRGNECVFGCNDQSWSLFCSRSRFSFRHNKQ
QTKLPVLSISSRIGVYVDHSAGTLSFYNVSDTMSLIYRVHTTFTQPLYPGFWVFAGSILF
TTDTVI
Download sequence
Identical sequences A8WG25
ENSDARP00000017772 XP_003197971.1.45394 XP_021326953.1.45394 ENSDARP00000017772 7955.ENSDARP00000017772

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]