SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000021935 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000021935
Domain Number 1 Region: 167-433
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.19e-80
Family Nuclear receptor ligand-binding domain 0.00000000313
Further Details:      
 
Domain Number 2 Region: 114-195
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.32e-31
Family Nuclear receptor 0.00000988
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000021935   Gene: ENSDARG00000005593   Transcript: ENSDART00000021168
Sequence length 439
Comment pep:known chromosome:Zv9:2:20495131:20546256:1 gene:ENSDARG00000005593 transcript:ENSDART00000021168 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDNNDTYLHLSSSLQVAHGHLSSPPSQPPLSSMVSHHHPSIINGLGSPYSVITSSSLGSP
SASMPTTSNMGYGALNSPQMNSLNSVSSSEDIKPPPGLAGLGSYPCGSPGSLSKHICAIC
GDRSSGKHYGVYSCEGCKGFFKRTIRKDLTYTCRDNKDCQIDKRQRNRCQYCRYQKCLAM
GMKREAVQEERQRGRERSDNEVDSSSSFNEEMPVEKILDAELAVEPKTEAYMESSMSNST
NDPVTNICQAADKQLFTLVEWAKRIPHFSDLPLDDQVILLRAGWNELLIASFSHRSVTVK
DGILLATGLHVHRSSAHSAGVGSIFDRVLTELVSKMREMDKTELGCLRAIVLFNPDAKGL
SNPSEVEALREKVYASLEGYTKHNYPDQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIG
DTPIDTFLMEMLEAPHQIT
Download sequence
Identical sequences ENSDARP00000021935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]