SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000022973 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000022973
Domain Number 1 Region: 140-419
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.13e-76
Family Nuclear receptor ligand-binding domain 0.00000000851
Further Details:      
 
Domain Number 2 Region: 88-169
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.55e-30
Family Nuclear receptor 0.0000127
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000022973   Gene: ENSDARG00000002006   Transcript: ENSDART00000021596
Sequence length 422
Comment pep:known chromosome:Zv9:16:20493224:20526536:1 gene:ENSDARG00000002006 transcript:ENSDART00000021596 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSLPPSTSAVSSPVSSVDSPLSAVSSSIGSPGVPGTPSIGYGPISNSQINSSMSVSALH
AVSSSDDVKPPFGLKSVSGSGPMLSQKRMCAICGDRSSGKHYGVYSCEGCKGFFKRTVRK
DLSYTCRDNKECLVDKRQRNRCQYCRYQKCLAMGMKREAVQEERQKNKERDGDYECSSSA
NEEMPVEKILEAETAVEHRTDLHSDATGSPNDPVTNICQAADKQLFTLVEWAKRVPHFSE
LPLDDQVILLRAGWNELLIAAFSHRSISVKDEILLATGLHVPKESTHNLGVEAFFDRESS
HSAEVGALFDRVLTELVCKMRDMQMDKTELGCLRAIVLFNPDAKGLTSSSEVELLREKVY
ASLESYCKQKYPDQQGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGNTPIDTFLMEMLES
PH
Download sequence
Identical sequences B3DG77
ENSDARP00000022973 ENSDARP00000022973 ENSDARP00000104696 XP_021322291.1.45394 XP_021322292.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]