SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000029754 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000029754
Domain Number 1 Region: 126-373
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 7.87e-70
Family Nuclear receptor ligand-binding domain 0.00000000717
Further Details:      
 
Domain Number 2 Region: 58-140
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.73e-30
Family Nuclear receptor 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000029754   Gene: ENSDARG00000021494   Transcript: ENSDART00000028236
Sequence length 463
Comment pep:known chromosome:Zv9:23:26143980:26153189:1 gene:ENSDARG00000021494 transcript:ENSDART00000028236 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLSKPLVDMEMADYSEALDPAYTTLEFENMQVLAMSTDSSPQESANMNAANHLGAGTLC
AICGDRATGKHYGASSCDGCKGFFRRSVRKNHMYSCRFNRQCIVDKDKRNQCRYCRLKKC
FRAGMKKEAVQNERDRISTRRSSYEDSSLPSINALIQADVLSRQISSPGPILNGDIRTKK
VAAIMDVCESMKQQLLVLVEWAKYIPAFCDLPLDDQVALLRAHAGEHLLLGAAKRSMMYK
DILLLGNDHIIPRNCPELEVSRVAVRILDELVLPFQDLQIDDNEYACLKAIVFFDPDAKG
LSDPSKIKRMRYQVQVSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFVKLF
GMAKIDNLLQEMLLGGSANEAPHAHHSLHPHLVQEHLSNNVIVTANMATPLHNGQMSTPE
TPIPSPPTASGSDHYKMASGVIATVPKQPSSIPQPTITKQEAI
Download sequence
Identical sequences Q6PHH5
7955.ENSDARP00000029754 ENSDARP00000029754 ENSDARP00000112924 ENSDARP00000029754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]