SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000039112 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000039112
Domain Number 1 Region: 368-549
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.91e-57
Family SPRY domain 0.0004
Further Details:      
 
Domain Number 2 Region: 8-81
Classification Level Classification E-value
Superfamily RING/U-box 2.87e-21
Family RING finger domain, C3HC4 0.0081
Further Details:      
 
Domain Number 3 Region: 139-204
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000168
Family B-box zinc-binding domain 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000039112   Gene: ENSDARG00000067985   Transcript: ENSDART00000029400
Sequence length 552
Comment pep:known chromosome:Zv9:2:48022167:48047591:1 gene:ENSDARG00000067985 transcript:ENSDART00000029400 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAESSISVAEDQFSCSVCLDLLKEPVTIPCGHSYCMNCITDCWNQDEQRRVYSCPQCRQT
FTPRPALNKNVVMAEMVEKLKTGSRNAASYAGPGDVECDVCTGRKRKAVKSCLMCLNSYC
QTHLEQHDSFFKDKRHHLINATGRLRQMICSKHDRLLEVYCHTDQKCICLLCMMDEHTGH
QTVSIKTERAEKQKLLLDLQRNFQKTIQEREEEVWELKHAVKTHKHSAQTAVEESERIFT
RLFHFIERRRSEVSQMIRDREKTEVSRAEGLLKKLEQEIEDLKRRNTELEQLSHTDDHIH
FLQSIPVLSVPPASSDISVSSLHSYDDVGKSISELREKLEDLCKEDIQQIFGKVTYMEIV
ASSGLKTRDEFLQYSCHLTLDLNTAHKYLRLSEGNRVATFIGADQSYPAHPDRFHDFSQV
LCRESVCGRCYWEVEWSGEAGVGISVSYKSIRRKEETNDSVFGYNGQSWRLSCSNSSYKF
RHNSNVVDLPVSSKSSKIGVYVDHRAGILSFFSVSDTMSLIHRVQTTFTQPLYPGFGINF
GSTIKLLLLKSL
Download sequence
Identical sequences ENSDARP00000039112 ENSDARP00000039112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]