SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000040404 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000040404
Domain Number 1 Region: 339-502
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 4.32e-29
Family Staphylococcal nuclease 0.0051
Further Details:      
 
Domain Number 2 Region: 522-666
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 1.7e-28
Family Staphylococcal nuclease 0.00093
Further Details:      
 
Domain Number 3 Region: 189-331
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 6.41e-27
Family Staphylococcal nuclease 0.0067
Further Details:      
 
Domain Number 4 Region: 17-168
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 2.09e-26
Family Staphylococcal nuclease 0.0026
Further Details:      
 
Domain Number 5 Region: 709-797
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 2.83e-20
Family Tudor domain 0.000018
Further Details:      
 
Domain Number 6 Region: 743-765,792-904
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 4.97e-16
Family Staphylococcal nuclease 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000040404   Gene: ENSDARG00000006766   Transcript: ENSDART00000040405
Sequence length 913
Comment pep:known chromosome:Zv9:4:18331363:18628526:-1 gene:ENSDARG00000006766 transcript:ENSDART00000040405 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASAVPAQVQSSQASAPQLQRGIVKMVLSGCAIIVRGQPRGGPPPERQINLSNIRAGALA
RRAIQGQPDTKDTPDEPWAFQAREFMRKKVIGKEVCFTVENKTPQGREYGMVYLGKDTSG
ENIAESLVAEGLAMVRREGIRGNNPEQVRLCDLEDQAKSSKKGLWSEGGGSHTIRDLKYT
IENPRNFVDSLHQKPVNAIIEHVRDGCMVRALLLPDYYLVTVMLSGIKSPTFKREADGSE
TPEPFAAEAKFFTESRLLQRDVQIILESCPNQVILGTILHPNGNITELLLKEGFARCVDW
SMAVYTQGAEKLRAAERSAKERKVRIWKDYVAPTANLDQKDRQFVAKVMQVVNADAIVVK
LNSGEYKTIHLSSIRPPRLEGEEKNKDKDKRFRPLYDIPYMFEAREFLRKKLIGKKVNVT
VDYIRAATNAMEMGVPAFPERTCATVTIGGINIAEALVSKGLATVIRYRQDDDQRSSHYD
ELLAAEARAIKNGKGLHSKKEVPIHRVADISGETQKAKQFFPFLQRAGRSEAVVEYVFSG
SRLKLYMPKETCLITFLLAGIECPRGSRNMPGGMQVAEPYSEEAMLFTKELVLQREVEVE
VESMDKAGNFIGWLHIEGVNLSVALVENALSKVHFTAERSSYYKTLVSAEESARQRKEKL
WANYEEKPKEEVAQVTEAKERVAKYRSVYVTEITDGLHFYAQDVETGTKLENLMESMRGE
IAAQPPVEGSFAPRRGEFCIAKFADGEWYRARVEKVESPAKVHVFYIDYGNREVLSSTRL
AALPPAFSTRTLPPQATEYAFAYIQVPQDEDARADAVDSVVRDIHNTQCLLNVEYSGSVC
PQVTLQFADTKEDVGLGLVKEGMVMVDIRKEKYLQKMVTEYLNAQESAKSARLNIWRYGD
FRDDDADEFGYRR
Download sequence
Identical sequences Q5RGK8
NP_878285.3.45394 ENSDARP00000040404 ENSDARP00000040404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]