SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000040700 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000040700
Domain Number 1 Region: 168-241
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 6.99e-25
Family PHD domain 0.0000195
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000040700   Gene: ENSDARG00000022413   Transcript: ENSDART00000040701
Sequence length 242
Comment pep:known chromosome:Zv9:22:2191784:2201649:-1 gene:ENSDARG00000022413 transcript:ENSDART00000040701 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATAIYLEHYLDSIENLPCELQRNFTLMRELDNRAEEKKCEIDKLAEEYIANVRNLAPDQ
RVEHLQKIQNGFSKCKEYSDDKVQLAMQTYEMVDKHIRRLDADLARFENELKEKLDVSGY
ESPDNRTHKKVTGRGNLKEKRRPKGRGRKSSDDESPRKKKMKNSPEFPESILPVHPSDVL
DMPVDPNEPTYCLCHQVSYGEMIGCDNPDCPIEWFHFACVDLTTKPKGKWFCPRCTQDRK
KK
Download sequence
Identical sequences A5WVS7
ENSDARP00000040700 ENSDARP00000040700 7955.ENSDARP00000034139 NP_001093519.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]