SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000044424 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000044424
Domain Number 1 Region: 340-523
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.94e-64
Family SPRY domain 0.0000123
Further Details:      
 
Domain Number 2 Region: 10-78
Classification Level Classification E-value
Superfamily RING/U-box 3.12e-19
Family RING finger domain, C3HC4 0.01
Further Details:      
 
Domain Number 3 Region: 137-184
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000183
Family B-box zinc-binding domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000044424   Gene: ENSDARG00000010940   Transcript: ENSDART00000044425
Sequence length 525
Comment pep:known chromosome:Zv9:7:20975567:20983342:1 gene:ENSDARG00000010940 transcript:ENSDART00000044425 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPFSRSFLSEEHLLCSICLEVFDNPVSSPCGHSFCMSCISHYWDTAKHCQCPLCKQTFKR
KPDLHINRTLREITEQFNEMKRKLIRRRSRDTSLACHNETGAEQTEQTTHADSDDTELPN
FARQVSLRRYSMCGAANAVKVPLCPKHHRNLELFCRTDLECICAECEQTEHQTHNITCAE
KIKISITETEIQEMARVRTQKAEEIKQSLIDINALAQHEAQRSMQLFGALISSLERSQAG
LLEVTEINRRSAEHQAELMIRELEQEITELRTKSTELTKLAQTDNYITGLKGYSDASTPV
SVKDWSSVSLSCDLGTEGICASVCQLLEQFKEELHFSEVKRIQEYAVDVTLDANTAHPRL
ILSENKKMVWCSENQQHVTNHRERFDRVVCVLGREGFNTGRHYWEVKVNGKTDWDLGVAS
HSCNRKGKIKVSPSHGYWFLSLRDKNNYAFRTEPPTVLHLSNKPQKMGLFVDYEKGQVSF
YDVDAKMHIHTFMDNFSETIYPFFSPCTNKNSKNEAPLVITPVLS
Download sequence
Identical sequences ENSDARP00000044424 ENSDARP00000044424 7955.ENSDARP00000044424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]