SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000046126 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000046126
Domain Number 1 Region: 23-112
Classification Level Classification E-value
Superfamily Hormone receptor domain 2.88e-20
Family Hormone receptor domain 0.00048
Further Details:      
 
Domain Number 2 Region: 126-394
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000000000000137
Family Rhodopsin-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000046126   Gene: ENSDARG00000028878   Transcript: ENSDART00000046127
Sequence length 440
Comment pep:known chromosome:Zv9:2:21026266:21094983:1 gene:ENSDARG00000028878 transcript:ENSDART00000046127 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDVSKQMLILYLTCSLGPMLSVQMCEVMWELEAEKRECLSKLENITSGCTGEWDLACWPS
ARIGEVVTIPCPNYFSHVSDQIGNISKSCTADGWTEINSVVVAYNCGYDPNITEDGNMGE
FLSSVRTGYTIGHTVSLISLIIAIIILCFFRKLHCTRNYIHIHLFMSFILKAVAVIMKDV
VLYEVEEPDDCHYGSVGCKAAMVFFQYGVMASFFWLLVEGLYLHALLAVSFFSERKYFWW
YILIGWGVPGVFITIWSITKAYLHDIGCWDFIDDDLWWIIKTPTLITILMNFILFICIIR
ILRQKISCRDIGRNESHQYSRLAKSTLLLIPLFGINYIIFAFMPHHIQSYIRLVFDLILG
SFQGFCVAVLYCFLNGEVQSEIKRKWRRWHMQRFLGADTKYHQPSTASNGLNFSSQITMM
TKCSPSTRRASACQDDFSAV
Download sequence
Identical sequences F1R788
ENSDARP00000046126 XP_002660843.2.45394 ENSDARP00000046126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]