SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000047528 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000047528
Domain Number 1 Region: 1-178
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.01e-46
Family BAR domain 0.0037
Further Details:      
 
Domain Number 2 Region: 291-407
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 3.66e-44
Family Pyk2-associated protein beta ARF-GAP domain 0.0001
Further Details:      
 
Domain Number 3 Region: 149-253
Classification Level Classification E-value
Superfamily PH domain-like 6.17e-28
Family Pleckstrin-homology domain (PH domain) 0.0042
Further Details:      
 
Domain Number 4 Region: 553-676
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.4e-25
Family Ankyrin repeat 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000047528   Gene: ENSDARG00000039386   Transcript: ENSDART00000047529
Sequence length 733
Comment pep:known chromosome:Zv9:11:3367329:3407273:1 gene:ENSDARG00000039386 transcript:ENSDART00000047529 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DVRKFKETKKQFDKVREDMEIAQVKNAQAPRNKPHEVEEATSTLITTRKCFRHLALDYVL
QINVLQAKKKFEILDSMLSFMQAQYGLFHQGFNLLDEIDPYMKKLAAELDQLVIDSAMEK
REMEHKHATIQQRTLMQDFAYDDSKVEFNVDAPNGVVMEGYLFKRASNAFKTWNRRWFSI
QNSQLVYQKRLKDALTVVVEDLRLCSVKPCEDIERRFCFEVVSPTKSCMLQAESEKLRQA
WIQAVQASIASAYREISENYYIERLDRTASPSTSSIDSASEPRERVVRGDSILQRVQCLP
GNEICCDCGQSDPRWASINLGILLCIECSGIHRSLGVHCSKVRSLTLDTWEPELMKLMCE
LGNTVINQIYEGACEEQGLKKPGPNSSRQEKEAWIKAKYVERKFLKKMCGSEALLEGGRK
SHHWSVKKCRRHNSSIRAPKTRRKYRHDAAIMSPGNLSAAAAAAKFRRESLFCPDELDSL
FSYFDTGSGPRSPAGLSSDSGLGGSTDGSTDILVFGSVVDSVTEEECEDSDESSGEVDIE
QEASDPEDGRELDPNTLLHKASRARNMPVMAEALAHGADVNSVSEEDESKSPLIQAVTGG
SLIACEFLLQNGADVNQRDIRGRGPLHHATCLGHTGQVCLFLKRGAGQMEVDEDGQDPLS
IAVQAANADIVTLLRLARMNEEMREADGPLGQPDASVPVSPLRVKRKSLRASPRSLSSFG
SFRTWLIYTPPKH
Download sequence
Identical sequences ENSDARP00000047528 ENSDARP00000047528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]