SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000049632 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDARP00000049632
Domain Number - Region: 4-36
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0331
Family PHD domain 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000049632   Gene: ENSDARG00000030803   Transcript: ENSDART00000049633
Sequence length 277
Comment pep:known chromosome:Zv9:10:36083294:36132121:-1 gene:ENSDARG00000030803 transcript:ENSDART00000049633 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEEEHFVNIDLNDDNICSICKLETDTGTLSFCHVCFELSIEGISSATLLHSKSLRGHRD
CFEKYHLIANQKLSRAKASHSTYEGVKRALSQRINRIIQYAQNRDSVTPENPGRWGAKQI
LCHTQQAGRKLVPQSDAQVPRYAPRWTEEASMVSESDYGKSMLDCHSAEELGLGLWPGER
PQNREQRDSRQRRHSGHSREELMRKNVEELRQLNEQLLLQIQNVFEELSVVVQEKDSLSS
ELHVRHIAIEQLFKNCAKLPWLQIGRAGVKAANNPVE
Download sequence
Identical sequences B2GSJ3 Q503Y8
ENSDARP00000049632 ENSDARP00000109773 7955.ENSDARP00000049632 ENSDARP00000049632 NP_001018388.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]