SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000052064 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000052064
Domain Number 1 Region: 246-485
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.78e-48
Family Voltage-gated potassium channels 0.001
Further Details:      
 
Domain Number 2 Region: 88-196
Classification Level Classification E-value
Superfamily POZ domain 1.62e-25
Family Tetramerization domain of potassium channels 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000052064   Gene: ENSDARG00000035861   Transcript: ENSDART00000052065
Sequence length 539
Comment pep:known chromosome:Zv9:2:23359248:23366668:1 gene:ENSDARG00000035861 transcript:ENSDART00000052065 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDQPRRHLKKLKKRRSSLFASAKLNASFSQSIEEEESAFPFSQDSSVKPWTSMDNLDTPS
PQKTDRREQEKRKSSEVEAAKMPHRHSTVINVNVGGKVFTIPKHLAVRYPKTRIGSLALC
KDPIKQLNLCDDYCVLTNEFFFDRDPTFFHYIFHFYCSNVLWVMESLCPVNFEEEMQFWG
LHLRDSPRCCRILYEEKIDEIRDQLKVNRELMAEIEPRHSEEGFKSMFLGDVRKVLWDLI
ENPYSSMSAKAFAVFSSLFVLISIVAMTLNTVSELKDYKVYGRTYMECVEITSILFFTFE
YFLRLLTTCDIKHFLKSALNFVDLVAVMPYFIQLVFEAFADQEDVSVQDDLKTMARVSKV
SKILKVVKLMRIFRILKLARHSTGMRAFGFTLRQCFEQVCCLFLFIIMGIFTFSALMHSV
EQDVAGTPFSSIPDAWWWAAVSISTVGYGDVVPISYSGRVVAFGCISFGIILNGMPISIL
FNKFSDYYAKLKAQECTNTNIQRGLNLKKRLRKKFDNCFEPQTEESDEDSRHHTGQCQH
Download sequence
Identical sequences F1QZV9
ENSDARP00000052064 XP_005171298.1.45394 ENSDARP00000052064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]