SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000052205 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000052205
Domain Number 1 Region: 369-615
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.57e-60
Family Nuclear receptor ligand-binding domain 0.0000000133
Further Details:      
 
Domain Number 2 Region: 248-326
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 7.13e-25
Family Nuclear receptor 0.0000305
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000052205   Gene: ENSDARG00000035966   Transcript: ENSDART00000052206
Sequence length 617
Comment pep:known chromosome:Zv9:18:40219884:40238456:1 gene:ENSDARG00000035966 transcript:ENSDART00000052206 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTVNTSPADSTGTVTGMSHLMEKYTDLGFGHGRVSLRNFGDAGTLRGSAPASSSDALDH
LSALDLPLGTKPYTEHIDDFLKAETGQWNAKTDCPESSYIKDDKELNLIMEPPNPDFDIT
VLESCYDSTERKQQCEFIEESSALISSQAIQQVVVDSSSNFQLDMNQTTLVLPPPRTVSA
SLDRGLLNFDVPSATHMMSKADISKWMSAADSPFWYQSANEEHAGYTPDCLIPRSQTAYT
AFSGVPSQRQCVICGDEASGCHYGVLTCGSCKVFFKRAVEGHHNYLCAGRNDCIVDKIRR
KNCPACRLRKCYQAGMMLGGRKMKRFAGLKVMGLSPSLMFQSPLSLLTDGQTLSSLPCMS
AMRELQLSPQMISILENIEPQVVYSGYDNTQPEVPHLLLNSLNRLCERQLLWIVRWSKSL
PGFRNLHINDQMTLIQYSWMGLMLFSLGWRTFQNVTPDYLYFAPDLVLSNDQLRRSPIYD
LCLAMQFVPQEFANLQVTKEEFLCMKALMLLNTVPLEGLKSQTQFDEMRQNYICELSKAI
QLKEKGVVASSQRFYHLTKLMDNMHEIVKKVNLYCLSTFIQADAMKVEFPEMMTEVIASQ
LPKVLAGMVKPLMFHHK
Download sequence
Identical sequences ENSDARP00000052205

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]