SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000052545 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000052545
Domain Number 1 Region: 130-409
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.25e-75
Family Nuclear receptor ligand-binding domain 0.00000000193
Further Details:      
 
Domain Number 2 Region: 77-156
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.03e-27
Family Nuclear receptor 0.0000138
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000052545   Gene: ENSDARG00000054003   Transcript: ENSDART00000052546
Sequence length 482
Comment pep:novel chromosome:Zv9:11:1991815:2049041:1 gene:ENSDARG00000054003 transcript:ENSDART00000052546 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATNRERPVSHMTGFYPFAFSSMRNHSPFDLLANGSLFGRFGADLPKEMAALSVETQSTS
SEEMIPSSPSPPPPPRVYKPCFVCQDKSSGYHYGVSSCEGCKGFFRRSIQKNMVYTCHRD
KNCQINKVTRNRCQYCRLQKCFEVGMSKEAVRNDRNKKKKDVKEEVVLPESYELSGELEE
LVNKVSKAHRETFPSLCQLGKYTTNSSADHRVQLDLGLWDKFSELSTKCIIKIVEFAKRL
PGFTSLTIADQITLLKSACLDILMLRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLT
DLVFAFAGQLLPLEMDDTETGLLSAICLICGDRMDLEEPHRVDQLQEPLLEALKIYARRR
RPNKPHMFPRMLMKVTDLRGISTKGAERAITLKMEIPGPMPPLIREMLENPEIFEDSSDS
NDSGAAAVVPAPNIKRERDEEEEDEDEEEDECAEEGRERAADSEDEELDSAGARKSSSGR
AQ
Download sequence
Identical sequences G1K2L7
ENSDARP00000052545 ENSDARP00000052545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]