SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000054263 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000054263
Domain Number 1 Region: 499-745
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 7.6e-65
Family Nuclear receptor ligand-binding domain 0.00000000474
Further Details:      
 
Domain Number 2 Region: 384-463
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.32e-25
Family Nuclear receptor 0.000015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000054263   Gene: ENSDARG00000025032   Transcript: ENSDART00000054264
Sequence length 746
Comment pep:known chromosome:Zv9:14:24652384:24705620:-1 gene:ENSDARG00000025032 transcript:ENSDART00000054264 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDQGGLENGKKRDERLNTLDYNKRATEGILPRRIQSTMSVAPTSMVPQAGPMMQPVSGDI
PNGLSNSPTLEEHTSSVSSIFGDDSELKLLGKEQRALQQQTLVPFTLGDSLSGLEASIAD
LNNPSPSMDSLIGGVDPNLFPLKTEDFSPMIKGDMDLDQDSFGHIGKDVDVGNHKLFSDN
TLDLLQDFELDGSPSDFYVADDAFLSTIGEDALLSELPTNLDRDSKAAVSGSNTLNGTAS
SSLSTANTSILPNIKVEKDSIIQLCTPGVIKQENTGASYCQGGLHSTPINICGVTTSSGQ
SFLFGNSSPTAVVGLQKDQKPDFNMYTPLTSSGDGWSRSQGFGNVSGMQQRASLCFSKNF
SSSPYSRPEDSTATSSAGGKTGTHKICLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHN
YLCAGRNDCIIDKIRRKNCPACRFRKCLMAGMNLEARKSKSKARQAGKVIQQQSIPERNL
PPLPEARALVPKPMPQLVPTMLSLLKAIEPDTLYAGYDSTIPDTSVRLMTTLNRLGGRQV
ISAVKWAKALPGFRNLHLDDQMTLLQCSWLFIMSFGLGWRSYQHCNGNMLCFAPDLVINE
ERMKLPYMSDQCEQMLKISNEFVRLQVSTEEYLCMKVLLLLNTVPKDGLKSQSVFDELRM
SYIKELGKAIVKREENSSQNWQRFYQLTKLLDSMHDLVGGLLNFCFYTFVNKSLSVEFPE
MLAEIISNQLPKFKDGSVKPLLFHQK
Download sequence
Identical sequences Q1XHK0
ENSDARP00000054263 7955.ENSDARP00000054263 NP_001018547.2.45394 ENSDARP00000054263 ENSDARP00000104980

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]