SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000054330 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000054330
Domain Number 1 Region: 5-136
Classification Level Classification E-value
Superfamily Hormone receptor domain 1.31e-25
Family Hormone receptor domain 0.00043
Further Details:      
 
Domain Number 2 Region: 125-397
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000000284
Family Rhodopsin-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000054330   Gene: ENSDARG00000037341   Transcript: ENSDART00000054331
Sequence length 432
Comment pep:known chromosome:Zv9:2:52451957:52511984:1 gene:ENSDARG00000037341 transcript:ENSDART00000054331 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTVVHLCLFAGFWRAMHAIHPDCAIISQLIQDQETCIQTRKREIKNHSQQTGCGTDWDGI
RCWHTANTGQLINVSCSDVFQHISNTQGFIYRNCMSNGWTDPYPPYEEACAFEDDSESGT
VTTYLSTLKQLYTAGYATSLISLITAVIIFTCFRKFHCTRNYIHINLFVSFILRASAVFI
KDTVLFSDETQDHCLMSTVLCKSAVTFFQFCILTNYFWLLVEGLYLQTLLALTFVSQRKY
FWWYILIGWGVPSVVLVVWVLTRQFYDNRGCWDDTDNMNIWWIIKGPITASLFANIIIFL
NVIRILVQKLKSPGVGGNDTGHFMRLAKSTLFLIPLFGMHYTLFAFLPENTGEIIRFYIE
LGLGSFQGFVVALLYCFLNGEVQAELKRRLWTWQTQTHLSPCKKRRVTVTQIMMHESAHP
HSDVCNGHITAV
Download sequence
Identical sequences A0A0R4IKR9
ENSDARP00000054330 7955.ENSDARP00000054330 ENSDARP00000054330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]