SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000055280 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000055280
Domain Number 1 Region: 202-455
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.44e-55
Family Voltage-gated potassium channels 0.001
Further Details:      
 
Domain Number 2 Region: 36-140
Classification Level Classification E-value
Superfamily POZ domain 1.65e-32
Family Tetramerization domain of potassium channels 0.0000165
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000055280   Gene: ENSDARG00000037933   Transcript: ENSDART00000055281
Sequence length 647
Comment pep:known chromosome:Zv9:24:38593472:38682990:1 gene:ENSDARG00000037933 transcript:ENSDART00000055281 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSSVCVSSFKGRKGGNKSSNKACYSADMTCPSESEKIVINCGGVRHETYRSTLKTLPGT
RLSWLTEPDAFSNFDYDPKSDEFFFDRHPSVFSFILNYYRTGKLHCPNDVCGPLFEEELA
FWGIDETDVEACCWMNYRQHRDAEEALDSFETPEPEVPDDDPALAGDGDLKRLCLQEDGR
KAGWWRVWRPRIWALFEDPYSSKYARYVAFGSLLFILISISTFCMETHEAFNTIYNKTEN
VTEGNVTREEIVYEVVTDSWLTYVEGVCVVWFTIEVFTRVVFCPDKMEFFKSPLNIIDFV
AVLPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNE
FLLLIIFLALGVLIFATMIYYAERIGASPDDPTASAHTNFKNIPIGFWWAVVTMTTLGYG
DMYPETWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPKKKNKHIPRAP
QPGSPNYCKPDALAMATASPQRILGNVLGGVLGSSGLTGDCPLAQEEIIEINRDSKQNGD
AASAALANEDCPTIDQVLSPDERSPVGRTQERYQQDRACFLLNTREFRPTDGNVRKATGY
EKSRSLNNISGMAGSSLRLTPITSTPFDPYEAPGPLRRCRSPIPSIL
Download sequence
Identical sequences E1AZA6
ENSDARP00000055280 ENSDARP00000055280 NP_001182170.1.45394 XP_021325880.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]