SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000055712 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000055712
Domain Number 1 Region: 7-127
Classification Level Classification E-value
Superfamily Hormone receptor domain 3.4e-30
Family Hormone receptor domain 0.0000364
Further Details:      
 
Domain Number 2 Region: 87-382
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000000632
Family Rhodopsin-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000055712   Gene: ENSDARG00000062377   Transcript: ENSDART00000055713
Sequence length 415
Comment pep:known chromosome:Zv9:2:2681130:2785846:1 gene:ENSDARG00000062377 transcript:ENSDART00000055713 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDASLFQFFLEEFGDLNCTLLDAFQDTLYENSSFASMSVDGVYCNATTDEIGTCWPRSNS
GRIIERPCPEYINGVKYNTTRIAYRECLENGTWALKSNYSNCEPILEEKRKYPMHYKIAL
IINYFGHCVSVGALIIAFILFLCLRSIRCLRNIIHWNLITTFILRNVMWFLLQLVDQNIY
ETNEPWCRLITTIYNYFVVTNFFWMFVEGCYLHTAIVMTYSTDKLRKWVFLFIGWCIPCP
IIIVWAIAKLYNENEQCWFGKEPGKYVDYIYQGPVILVLLINFVFLFNIVRILMTKLRAS
TTSETIQYSRKAVKATLVLLPLLGITYMLFFVNPGEDDISQIVFIYFNSFLQSFQGFFVS
VFYCFLNGEVRSAARKRWHRWQDNHALRVRVARAMSIPTSPTRISFHSIKQTTAV
Download sequence
Identical sequences ENSDARP00000055712 ENSDARP00000055712

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]